Maryland's Defense Patent Database

The defense community in Maryland is an R&D powerhouse.

Use this database to see the innovative patents that are poised for commercialization.

Peptides responsive to antibodies against consensus peptide of the CS4-CFA/I family proteins

Patent image
AMRMC

This invention relates to amino acid sequences from within a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA(SEQ ID. NO: 1) Eight mer peptides from within the consensus peptide were tested against an antibody raised to the consensus peptide. Studies relating to antibody raised to denatured proteins from the natural organisms producing the family of proteins were also useful and showed particular value of some sequences. A sequence of the formula ASVDPTIDLLQA (SEQ ID NO: 2) was identified thereby. An enlarge sequence of the formula TVTASVDPTIDLLQAD (SEQ ID NO: 3) is also especially interesting as are intermediate sequences such as sequences VTASVDPTIDLLQAD (SEQ ID NO: 4), TASVDPTIDLLQAD (SEQ ID NO: 5), and TASVDPTIDLLQA (SEQ ID NO: 6) as being binding sites for antibodies raised to the denatured proteins.

Inventors: 
Cassels, Frederick J.; Loomis-price, Lawrence
Patent Number: 
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2004-01-12
Grant Date: 
2008-07-29
Grant time: 
1,660 days
Grant time percentile rank: 
30
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY