Maryland's Defense Patent Database

The defense community in Maryland is an R&D powerhouse.

Use this database to see the innovative patents that are poised for commercialization.

Monoclonal antibody which agglutinates <i>E. coli </i>having the CS4-CFA/I family protein

Patent image
MRDC

A monoclonal antibody to a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA.(SEQ ID NO:1) The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS (SEQ ID NO:2) and has use as a diagnostic and for prophylaxis against illness arising from E. coli which produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom.

Inventors: 
Cassels, Frederick J.; Lees, Andrew; Schuman, Richard F.
Patent Number: 
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2004-06-10
Grant Date: 
2009-07-28
Grant time: 
1,874 days
Grant time percentile rank: 
34
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY