Maryland's Defense Patent Database

The defense community in Maryland is an R&D powerhouse.

Use this database to see the innovative patents that are poised for commercialization.

Burn patient resuscitation system and method

Patent image
AMRMC

A method and system for operating a semi-closed loop and/or a closed loop resuscitation of a burn patient in view of patient information and other physiological data gathered as part of the method and/or by the system. The method in at least one embodiment includes receiving patient information, calculating an infusion rate based at least on part on a portion of the received patient information, outputting the infusion rate to an infusion pump, obtaining a urinary output, calculating a new infusion rate using infusion rate model based constants, and outputting the new infusion rate to an infusion pump. In some embodiments, the method includes notifying medical staff when problems arise, displaying information regarding the resuscitation, and setting limits regarding the infusion rates.

Inventors: 
Salinas, Jose; Kramer, George; Drew, Guy A.
Patent Number: 
US7857803
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-03-19
Grant Date: 
2010-12-28
Grant time: 
1,014 days
Grant time percentile rank: 
18
Claim count percentile rank: 
5
Citations percentile rank: 
3
'Cited by' percentile rank: 
1
Assignee: 
UNIV TEXAS

Highly efficient surface enhanced Raman and fluorescence nanostructure substrates

Patent image
NRL

An apparatus comprising a substrate and at least two nanowires on the substrate, the nanowires comprising a core and a metal shell, wherein the core is selected from the group consisting of a semiconductor and a dielectric, thereby forming a nanowire-composite to allow plasmon coupling for enhancements of the electric fields and enhancements of the surface enhanced Raman signal (SERS) and enhancements of the chemical or biological specificity and sensitivity. A method of making a SERS-active substrate comprising providing a substrate and affixing a plurality of nanowires on the substrate thereby forming a nano-composite, creating plasmon coupling leading to enhanced electric fields in the vicinity of the nanowires and enhancements of the surface enhanced Raman signal (SERS) and enhancements of the chemical or biological specificity and sensitivity.

Inventors: 
Prokes, Sharka M.; Glembocki, Orest J.
Patent Number: 
US7639356
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-04-08
Grant Date: 
2009-12-29
Grant time: 
630 days
Grant time percentile rank: 
11
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Aptamer drug for detoxification of <i>Staphylococcus aureus </i>alpha-toxin

Patent image
NMRC

Aptamers and methods of use thereof are presented for the treatment or diagnosis of Staphylococcus aureus infection. The aptamers binds to and capable of neutralization of Staphylococcus aureus alpha-toxin.

Inventors: 
Vivekananda, Jeevalatha; Millenbaugh, Nancy J.
Patent Number: 
US9217134
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2014-08-27
Grant Date: 
2015-12-22
Grant time: 
482 days
Grant time percentile rank: 
8
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Molecular concentrator based on thermal ratcheting

Patent image
NRL

A molecular concentrator comprising a thermal ratchet for driving molecules from one place to another. A plurality of conducting wires are arranged on or suspended above a substrate. Each of the wires is configured to strongly sorb a vapor of interest when the wire is at room temperature and to rapidly desorb the vapor when the wire is at an elevated temperature. By selectively heating and cooling the wires, vapor molecules incident on the wires can be directed in a desired manner, e.g., from the wires closest to the vapor-containing environment to a sensor.

Inventors: 
Ancona, Mario; Snow, Arthur W.; Perkins, Keith F.
Patent Number: 
US8986615
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2014-05-16
Grant Date: 
2015-03-24
Grant time: 
312 days
Grant time percentile rank: 
5
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

System and method for testing of micro-sized materials

Patent image
NRL

Apparatus and methods for testing sediment submerged in liquid and manufacturing the apparatus.

Inventors: 
Reed, Allen Hagerman; Zhang, Guoping; Yin, Hang; Young, David C.
Patent Number: 
US9304071
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2015-02-12
Grant Date: 
2016-04-05
Grant time: 
418 days
Grant time percentile rank: 
7
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Production of recombinant protein pap 31 for the diagnosis and prevention of Bartonella bacilliformis infection

Patent image
NMRC

The invention relates to a recombinant DNA and polypeptide sequence of an immuno-dominant phage particle associated protein from Bartonella bacilliformis. The recombinant protein is easily produced permitting the conduct of more accurate and rapid diagnositic assays for the detection of B. bacilliformis infection with reduced reagent and equipment requirements over that required by currently available methods of diagnosis. The DNA and polypeptide sequence is also useful in vaccine preparations against B. bacilliformis.

Inventors: 
Ching, Wei-mei; Hendrix, Laura; Gonzalez, Jesus
Patent Number: 
US7201902
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2005-09-23
Grant Date: 
2007-04-10
Grant time: 
564 days
Grant time percentile rank: 
10
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Hand-held fluorescence polarimeter

Patent image
NMRC

A small, portable, hand-sized apparatus for detecting microorganisms or chemicals in liquid samples by fluorescence polarization. The apparatus operates using a low power excitation light source, such as an LED, in order to irradiate a sample with polarized light. Detection of emitted polarized light from the sample is detected in multiple planes simultaneously using low power detectors resulting in an elimination of error caused by drifts in intensity in sequential measurements and in reducing assay time.

Inventors: 
Cullum, Malford E.; Naday, Istvan; Mcarthur, Alan L.
Patent Number: 
US7528952
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2005-06-02
Grant Date: 
2009-05-05
Grant time: 
1,433 days
Grant time percentile rank: 
26
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Recombinant chimeric antigens for diagnosis and prevention of scrub typhus

Patent image
NMRC

Recombinant chimeric antigens comprising unmodified and modified reactive polypeptide fragments of expressed product of the recombinant 56 kDa proteins of multiple strain of scrub typhus, such as Karp, Kato (Ktr56), Gilliam (Gmr56), and TA763 (TAr56). The invention is useful for detecting prior exposure to a number of strains of scrub typhus, based on the strength of reaction toward the chimeric protein and as a component in vaccine formulations and production of immune globulins for passive prophylaxis and immunity in subjects against heterologous infections.

Inventors: 
Ching, Wei-mei; Chao, Chien-chung
Patent Number: 
US8142787
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-05-10
Grant Date: 
2012-03-27
Grant time: 
322 days
Grant time percentile rank: 
5
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Near-IR laser-induced vibrational overtone absorption systems and methods for material detection

Patent image
ARL

Embodiments of present invention are directed to near infrared (IR) laser-induced vibrational absorption systems and methods for material detection. According to one embodiment, a system for detecting materials may include: at least one laser configured to output light in the near IR spectrum so as to excite at least one vibrational overtone frequency, at least one combination band frequency, or a combination thereof, of a sample comprised of one or more of materials; a detector configured to detect a physical phenomenon of the sample in response to laser excitation; and an analyzer configured to the analyze the detected physical phenomenon and to identify the one or more materials based comparison of the detected signatures with known signatures of one more materials.

Inventors: 
Sausa, Rosario; Cabalo, Jerry B.
Patent Number: 
US9335267
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2013-01-24
Grant Date: 
2016-05-10
Grant time: 
1,202 days
Grant time percentile rank: 
22
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Recombinant antigens for the detection of <i>Coxiella burnetii</i>

Patent image
NMRC

The invention relates to a method for the detection of prior exposure to Coxiella burnetii infection by antibody-based assays using recombinant, immunodominant C. burnetii polypeptides. The invention also relates to the design of biotin or His-tagged C. burnetii proteins useful in the antibody-based assays as standardized antigen reagents.

Inventors: 
Ching, Wei-mei; Chao, Chien-chung; Li, Xuan; Chen, Hua-wei
Patent Number: 
US7824875
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2007-12-11
Grant Date: 
2010-11-02
Grant time: 
1,057 days
Grant time percentile rank: 
19
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Fluorescent organic nanoparticles

Patent image
NRL

A nanoparticle having a surfactant shell with a hydrophilic outer surface and a hydrophobic inner surface and an organic chromophore and a polymer having aromatic groups within the surfactant shell. A method of making nanoparticles by: emulsifying an aqueous composition of a surfactant and an organic solution of a monomer and an organic chromophore to form micelles of the monomer and the chromophore inside a surfactant shell; and polymerizing the monomer. A method of: reacting a ω-bromoalkyl acid with acryloyl acid lithium salt, and reacting the product with sodium hydride to produce an acryloyloxyalkyl carboxylic acid sodium salt. The compound shown below.

Inventors: 
Naciri, Jawad; Spillmann, Christopher M.; Anderson, George P.; Ratna, Banahalli R.
Patent Number: 
US9201010
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2009-04-29
Grant Date: 
2015-12-01
Grant time: 
2,407 days
Grant time percentile rank: 
44
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Node excitation driving function measures for cerebral cortex network analysis of electroencephalograms

Patent image
ARL

Methods and apparatuses for estimating brain activity of a human subject from the measurement of electroencephalograms (EEG) are disclosed. In one method, cortical neural sources in the cerebral cortex of the brain of the subject are specified. Next, using a model of the human brain which treats the cortical neural sources as nodes in a cortical source network, cortical source activations are estimated from the measured electroencephalograms for each of the cortical neural sources in the network for the subject. Source network modulation control signals are then determined for the subject from the cortical source activations which are assumed to correspond to control modulators in the human brain. And a network activity classification is computed from determined modulation control signals for the subject. The innovative technology may be included in an automated aiding system in the electronic aiding of tasks performed by human operators.

Inventors: 
Smyth, Christopher C.
Patent Number: 
US9107595
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2014-09-29
Grant Date: 
2015-08-18
Grant time: 
323 days
Grant time percentile rank: 
5
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Recombinant antigen for diagnosis and prevention of murine typhus

Patent image
NMRC

The invention relates to a recombinant immunogenic composition from Rickettsia typhi. The invention also relates to a method for the use of the recombinant proteins in detection and diagnostic assays and as a component in formulations for the induction of an anti-R. typhi immune response.

Inventors: 
Ching, Wei-mei; Chen, Hua-wei
Patent Number: 
US8900818
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-03-15
Grant Date: 
2014-12-02
Grant time: 
1,358 days
Grant time percentile rank: 
24
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Binding interaction of proanthocyanidins with bacteria and bacterial components

Patent image
NRL

A composition having proanthocyanidin compounds having an average degree of polymerization of at least about 6. A method of administering to an immunosuppressed patient or a patient diagnosed with sepsis or septic shock a composition having a proanthocyanidin. A method of administering to a patient diagnosed with a gram negative bacterial infection a composition having proanthocyanidin compounds having an average degree of polymerization of at least about 6.

Inventors: 
Delehanty, James B.; White, Brandy J.; Lin, Baochuan; Ligler, Frances S.
Patent Number: 
US9040250
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2007-08-02
Grant Date: 
2015-05-26
Grant time: 
2,854 days
Grant time percentile rank: 
52
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Wireless bio-interface data transmission system

Patent image
NRL

A method and an apparatus to drive an analog signal into a sensory tissue. The apparatus includes an analog-to-digital converter converting an original analog signal to a digital signal at an analog-to-digital converter sample rate. The apparatus includes a digital transceiver communicating wirelessly with the analog-to-digital converter to receive the digital signal. The apparatus includes a digital data buffer receiving the digital signal from the digital transceiver. The apparatus includes a digital-to-analog converter communicating with the digital data buffer and converting the digital signal into a reconstructed analog signal at a digital-to-analog converter sample rate faster than the analog-to-digital converter sample rate, the analog signal comprising a plurality of intensity values. The apparatus includes a pixel clock matching the digital-to-analog converter sample rate. The apparatus includes a bio-interface array comprising a plurality of electrodes and operably proximate to the sensory tissue.

Inventors: 
Johnson, Lee James
Patent Number: 
US8536901
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-12-02
Grant Date: 
2013-09-17
Grant time: 
655 days
Grant time percentile rank: 
11
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Reduced-oxygen breathing device

Patent image
NMRC

The present invention includes a non-rebreathing circuit coupled with computer-controlled gas adjustments. Ambient air is diluted with nitrogen on a breath-by-breath basis to provide precise control over the inspired concentration of oxygen/nitrogen mixture, thereby simulating selected altitudes on an almost instantaneous basis. Carbon dioxide and water vapor exhaled by the subject are released into the environment and absorption is not necessary. In addition, the mixed gas can be administered through a standard aviator's oxygen mask, increasing the realism of the simulation and removing obvious external cues on the nature of the experiment. Maintenance on the mixing loop is low when compared to re-breathing units, since no consumable items are necessary to absorb water vapor or carbon dioxide. A mixing device provides a homogenized mixture of nitrogen/oxygen fluid to the subject.

Inventors: 
Wartman, Richard; Stiney, Michael; Bower, Eric; Gardetto, Paul; Vacchiano, Charles; Sausen, Kenneth
Patent Number: 
US6871645
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2002-09-16
Grant Date: 
2005-03-29
Grant time: 
925 days
Grant time percentile rank: 
16
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
2
Assignee: 
US NAVY

Nonlinear blind demixing of single pixel underlying radiation sources and digital spectrum local thermometer

Patent image
NSWCDD

Changes, increase or decrease, in the body fluid flow are passively detected by using a single pixel, non-linear blind de-mixing procedure, which can be extended to general biomedical measurement and diagnoses instruments. More specifically the single pixel, non-linear blind de-mixing procedure is applied on the hot spots of rheumatic arthritis or breast cancer detection problem using passive two-color infrared imaging as well as to passively detect blockages in the body fluid circulatory system that might be of importance for coronary artery bypass surgery, diabetes and deep vein thrombosis. Other applications of the mentioned algorithm include a pair of cameras for video, a pair of antennas for cell phones, and in situ data gathering or imaging using multiple mode fiberoptical sensing as well as selective amplification hearing aids through two-ear binaural processing for de-noise echo cancellation and signal classification.

Inventors: 
Szu, Harold H.; Buss, James R.; Kopriva, Ivica
Patent Number: 
US7366564
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2003-08-22
Grant Date: 
2008-04-29
Grant time: 
1,712 days
Grant time percentile rank: 
31
Claim count percentile rank: 
3
Citations percentile rank: 
2
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Systems and methods for suppressing motion sickness

Patent image
ARL

Systems for suppressing motion sickness are provided. In this regard, an exemplary system comprises a display device and a display controller. The display device is operative to display a first image and a second image. The display controller communicates with the display device and is operative to control display of the second image such that the second image moves relative to the display device in response to at least one of: motion of the first image relative to the display device, and motion of the display device. Methods and other systems also are provided.

Inventors: 
Smyth, Christopher C.; Smyth, David C.
Patent Number: 
US7918781
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-03-22
Grant Date: 
2011-04-05
Grant time: 
1,840 days
Grant time percentile rank: 
33
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Compact, all-optical generation of coherent X-rays

Patent image
NRL

A method for generating coherent, polarized, and tunable X-rays using a single laser pulse is provided. An ultrashort laser pulse is fired into a plasma. As the laser beam travels through the plasma, some of its photons are backscattered, e.g., through Raman backscattering, to generate a counter-propagating photon beam that is co-linear with the original laser beam. When the backscattered photons interact with high-energy accelerated periodic electron bunches, coherent X-rays are generated through Compton backscattering of the photons off of the electrons. The energy of the backscattered X-rays can be tuned by tuning one or more characteristics of the laser pulse and/or the plasma.

Inventors: 
Kaganovich, Dmitri; Ting, Antonio C.; Helle, Michael H.; Gordon, Daniel F.; Hafizi, Bahman; Palastro, John
Patent Number: 
US9370085
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2015-07-14
Grant Date: 
2016-06-14
Grant time: 
336 days
Grant time percentile rank: 
6
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Antimicrobial peptide and methods of use thereof

Patent image
AMRMC

A method of preventing biofilm formation in an environment including the steps of administering to the environment an effective amount of a peptide having the amino acid sequence NH2-lys-lys-val-val-phe-lys-val-lys-phe-lys-CONH2 [SEQ ID NO: 1] The method is useful in preventing the formation of biofilms in various environments including a home, workplace, laboratory, industrial environment, aquatic environment, animal body or human body. A method of inhibiting the growth of oral microorganisms including the steps of administering to an oral environment an effective amount of a peptide having the amino acid sequence NH2-lys-val-val-phe-lys-val-lys-phe-lys-CONH2 [SEQ ID NO: 1].

Inventors: 
Leung, Kai P.; Concannon, Sean P.
Patent Number: 
US7494980
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2004-03-09
Grant Date: 
2009-02-24
Grant time: 
1,813 days
Grant time percentile rank: 
33
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Neural stem cell-collagen-bioreactor system to construct a functional embryonic brain-like tissue

Patent image
NRL

A method of generating tissue from stem and progenitor cells is disclosed. Primary mammalian stem cells and progenitor cells are placed in an extracellular matrix. The matrix is maintained in a culture medium and a microgravity environment.

Inventors: 
Ma, Wu
Patent Number: 
US7588938
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2004-08-04
Grant Date: 
2009-09-15
Grant time: 
1,868 days
Grant time percentile rank: 
34
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Reagentless and reusable biosensors with tunable differential binding affinities and methods of making

Patent image
NRL

The biosensor comprises a modular biorecognition element and a modular flexible arm element. The biorecognition element and the flexible arm element are each labeled with a signaling element. The flexible arm contains an analog of an analyte of interest that binds with the biorecognition element, bringing the two signaling elements in close proximity, which establishes a baseline fluorescence resonance energy transfer (FRET). When an analyte of interest is provided to the biosensor, the analyte will displace the analyte analog, and with it, the signaling module of the modular flexible arm, causing a measurable change in the FRET signal in a analyte concentration dependent manner. The modularity of different portions of the biosensor allows functional flexibility. The biosensor-operates without additional development reagents, requiring only the presence of analyte or target for function.

Inventors: 
Medintz, Igor L.; Goldman, Ellen R.; Anderson, George P.; Mauro, Matthew J.
Patent Number: 
US7435386
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2005-03-25
Grant Date: 
2008-10-14
Grant time: 
1,299 days
Grant time percentile rank: 
23
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Multiplexed polymerase chain reaction for genetic sequence analysis

Patent image
NRL

A PCR method involving: providing a biological sample suspected of containing one or more pathogen nucleic acids; adding a plurality of PCR primers corresponding to genes found in the pathogens; and performing a polymerase chain reaction on the sample to amplify a subset of the nucleic acids that correspond to the genes. The primers include at least one primer pair for each pathogen, and the primers contain a tail sequence that is not homologous any pathogen DNA or to any background DNA in the sample. The concentration of at least one primer in the polymerase chain reaction is no more than about 100 nM.

Inventors: 
Lin, Baochuan; Blaney, Kate M.; Malanoski, Anthony P.; Schnur, Joel M.; Stenger, David A.
Patent Number: 
US7695941
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-06-06
Grant Date: 
2010-04-13
Grant time: 
1,407 days
Grant time percentile rank: 
25
Claim count percentile rank: 
7
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Cell and biofactor printable biopapers

Patent image
NRL

Disclosed herein is a structure having: a porous polymeric film permeated by a first extracellular matrix material; and a topcoat layer comprising a second extracellular matrix gel disposed on the film. Also disclosed herein is a method of: providing a porous polymeric film; permeating the film with a first extracellular matrix material; and applying a topcoat layer of a second extracellular matrix material to the film. Also disclosed herein is a method of: laser-machining holes through a film comprising collagen to form a web-like structure.

Inventors: 
Ringeisen, Bradley R.; Pirlo, Russell K.; Wu, Peter K.
Patent Number: 
US8669086
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-04-29
Grant Date: 
2014-03-11
Grant time: 
1,047 days
Grant time percentile rank: 
19
Claim count percentile rank: 
6
Citations percentile rank: 
2
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Micro blood vessels and tissue ducts

Patent image
NRL

A fiber includes one or more layers of polymer surrounding a central lumen, and living animal cells disposed within the lumen and/or within at least one of the one or more layers, wherein the fiber has an outer diameter of between 5 and 8000 microns and wherein each individual layer of polymer has a thickness of between 0.1 and 250 microns. Also disclosed are model tissues including such fibers, and method of making such fibers. The fibers can serve as synthetic blood vessels, ducts, or nerves.

Inventors: 
Ligler, Frances S.; Adams, André A.; Daniele, Michael
Patent Number: 
US9157060
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2013-03-04
Grant Date: 
2015-10-13
Grant time: 
953 days
Grant time percentile rank: 
17
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Bacteria-based gas generator

Patent image
NRL

Disclosed is an apparatus having: a pressure chamber and a gas-producing microorganism within the chamber. The pressure chamber is capable of maintaining a gas pressure of at least 0.5 psi above atmospheric pressure.

Inventors: 
Spargo, Barry J.; Biffinger, Justin C.; Ringeisen, Bradley R.; Howard, Erinn C.; Fitzgerald, Lisa A.; Wu, Peter K.; Malito, Michael P.
Patent Number: 
US9327804
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-05-20
Grant Date: 
2016-05-03
Grant time: 
1,810 days
Grant time percentile rank: 
33
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

<i>Plasmodium vivax </i>hybrid circumsporozoite protein and vaccine

Patent image
AMRMC

Described in this application is a synthetic P. vivax circumsporozoite protein useful as a diagnostic reagent, for antibody production, and as a vaccine protective against infection with any strain of P. vivax.

Inventors: 
Yadava, Anjali; Ockenhouse, Christian F.
Patent Number: 
US7790186
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-01-18
Grant Date: 
2010-09-07
Grant time: 
1,693 days
Grant time percentile rank: 
31
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
2
Assignee: 
US ARMY

Compositions and methods for inhibiting expression of a gene from the Ebola virus

Patent image
AMRMC

The invention relates to a double-stranded ribonucleic acid (dsRNA) for inhibiting the expression of a gene from the Ebola virus.

Inventors: 
Bavari, Sina; Warfield, Kelly Lyn; Tan, Pamela; Borodovsky, Anna; Novobrantseva, Tatiana; De Fougerolles, Antonin
Patent Number: 
US8735369
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2012-09-26
Grant Date: 
2014-05-27
Grant time: 
608 days
Grant time percentile rank: 
11
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
ALNYLAM PHARMACEUTICALS INC

Truncated recombinant major outer membrane protein antigen (R56) of <i>Orientia tsutsugamushi </i>strains Karp, Kato and Gilliam and its use in antibody based detection assays and vaccines

Patent image
NMRC

A recombinant, refolded non-fusion polypeptide expressed from a truncated r56 gene of the causative agent of scrub typhus, Orientia tsutsugamushi for the Karp, Kato and Gilliam strains has been produced. The invention is useful for detecting prior exposure to scrub typhus, screening for and/or identification of at least one infectious strain-similarity (i.e. a Karp-like, Kato-like or Gilliam-like strain) based on its strength of reaction toward a truncated protein and as a component in vaccine formulation sand production of immune globulins for passive prophylaxis and immunity in subjects.

Inventors: 
Ching, Wei-mei; Kelly, Daryl J.; Dasch, Gregory A.
Patent Number: 
US7638130
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2007-12-27
Grant Date: 
2009-12-29
Grant time: 
733 days
Grant time percentile rank: 
13
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Truncated recombinant major outer membrane protein antigen (r56) of Orientia tsutsugamushi strains Karp, Kato and Gilliam and its use in antibody based detection assays and vaccines

Patent image
NMRC

A recombinant, refolded non-fusion polypeptide expressed from a truncated r56 gene of the causative agent of scrub typhus, Orientia tsutsugamushi for the Karp, Kato and Gilliam strains has been produced. The invention is useful for detecting prior exposure to scrub typhus, screening for and/or identification of at least one infectious strain-similarity (i.e. a Karp-like, Kato-like or Gilliam-like strain) based on its strength of reaction toward a truncated protein and as a component in vaccine formulations and production of immune globulins for passive prophylaxis and immunity in subjects.

Inventors: 
Ching, Wei-mei; Kelly, Daryl J.; Dasch, Gregory A.
Patent Number: 
US7335477
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2002-04-12
Grant Date: 
2008-02-26
Grant time: 
2,146 days
Grant time percentile rank: 
39
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

RT-LAMP assay for the detection of pan-serotype dengue virus

Patent image
NMRC

The invention relates to a reverse transcription loop-mediated isothermal amplification (LAMP) assay for the detection of dengue virus. The assay is capable of simultaneous detection of dengue 1-4 serotypes in a single reaction.

Inventors: 
Dauner, Allison; Pal, Subhamoy; Wu, Shuenn-jue
Patent Number: 
US8685649
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-06-09
Grant Date: 
2014-04-01
Grant time: 
1,027 days
Grant time percentile rank: 
18
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Silica mesoporous aerogels having three-dimensional nanoarchitecture with colloidal gold-protein superstructures nanoglued therein

Patent image
NRL

This disclosure describes the first viable non-enzyme protein encapsulated within an aerogel. In this, a large excess of cyt c is added to a commercial buffered Au sol solution ( ) which results in the formation of a gold˜protein-protein superstructure in the absence of separation techniques which destroy the superstructure. The gold˜protein-protein superstructure is then nanoglued into a silica framework during the sol to gel transition. To form the gel, the Au˜cyt. c superstructure in buffered medium is added to a silica sol and the composite gels are washed with acetone followed by liquid carbon dioxide and then supercritically dried to form the aerogel.The biocomposite aerogels have a multiplicity of applications particularly in the realm of sensing and energy transformation.

Inventors: 
Rolison, Debra R.; Wallace, Jean M.; Pietron, Jeremy J.; Rice, Jane K.; Stroud, Rhonda M.
Patent Number: 
US7238729
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2004-08-18
Grant Date: 
2007-07-03
Grant time: 
1,049 days
Grant time percentile rank: 
19
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Ebola virion proteins expressed from venezuelan equine encephalitis (VEE) virus replicons

Patent image
AMRMC

Using the Ebola GP, NP, VP24, VP30, VP35 and VP40 virion proteins, a method and composition for use in inducing an immune response which is protective against infection with Ebola virus is described.

Inventors: 
Hart, Mary K.; Wilson, Julie A.; Pushko, Peter; Smith, Jonathan F.; Schmaljohn, Alan L.
Patent Number: 
US6984504
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2003-10-29
Grant Date: 
2006-01-10
Grant time: 
804 days
Grant time percentile rank: 
14
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Recombinant Plasmodium vivax merozoite protein-1 p42 vaccine

Patent image
AMRMC

In this application is the expression and purification of a recombinant Plasmodium vivax (SalI) PvMSP-1 p42. The method of the present invention produces a highly purified protein which retains folding and disulfide bridging of the native molecule. The recombinant PvMSP-1 p42 is useful as a diagnostic reagent, for use in antibody production, and as a vaccine.

Inventors: 
Lanar, David E.; Dutta, Sheetij; Ware, Lisa A.
Patent Number: 
US7150875
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2002-03-18
Grant Date: 
2006-12-19
Grant time: 
1,737 days
Grant time percentile rank: 
32
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Altered superantigen toxins

Patent image
AMRMC

The present invention relates to genetically attenuated superantigen toxin vaccines altered such that superantigen attributes are absent, however the superantigen is effectively recognized and an appropriate immune response is produced. The attenuated superantigen toxins are shown to protect animals against challenge with wild type toxin. Methods of producing and using the altered superantigen toxins are described.

Inventors: 
Ulrich, Robert G.
Patent Number: 
US7750132
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-01-17
Grant Date: 
2010-07-06
Grant time: 
1,631 days
Grant time percentile rank: 
30
Claim count percentile rank: 
2
Citations percentile rank: 
2
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Concentrator device and method of concentrating a liquid sample

Patent image
AECBC

A concentrator device and method of concentrating a liquid sample may be provided. The concentrator device may include a pressure vessel and a filter element disposed within the pressure vessel. The pressure vessel may include an inlet configured to introduce pressurized air into a first portion of the pressure vessel and a first outlet fluidly coupled with a second portion of the pressure vessel. The first outlet may be adapted to be selectively opened and closed. A second outlet may be configured to receive a capillary tube inserted into the first portion of the pressure vessel. The filter element may be configured to receive a liquid sample to be concentrated. The filter element may substantially separate the first portion of the pressure vessel from the second portion of the pressure vessel and may define a retentate side adjacent to the first portion and a filtrate side adjacent to the second portion. When pressurized air is introduced through the inlet and the first outlet is open, a filtrate of the liquid sample received in the filter element may pass from the retentate side to the filtrate side such that a concentrated retentate of the liquid sample remains on the retentate side. When the first outlet is closed, the concentrated retentate of the liquid sample may be forced out through the capillary tube.

Inventors: 
Wick, Charles H.
Patent Number: 
US8146446
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2009-03-10
Grant Date: 
2012-04-03
Grant time: 
1,120 days
Grant time percentile rank: 
20
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Hand-held device with reagents and method for detection and diagnostics

Patent image
AECBC

A hand-held device and method of processing a biological threat agent sample such that any infectious organism is rendered harmless while preserving it for subsequent testing, the method comprising placing a sample comprising a biological threat agent in a reservoir; adding a first reagent comprising peracetic acid in sufficient concentration to reach a predetermined minimal concentration after mixing with the sample in the reservoir; inactivating the sample upon interaction of the sample with the first reagent for a predetermined period of time at a predetermined temperature; removing the inactivated sample from the reservoir; and providing the inactivated sample for subsequent diagnostic testing, wherein the subsequent diagnostic testing is unaffected by inactivation of the sample. In another embodiment, the first reagent comprises a cupric salt, which is mixed with ascorbic acid and hydrogen peroxide to generate cupric ascorbate.

Inventors: 
Sagripanti, Jose-luis
Patent Number: 
US8658088
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2012-04-12
Grant Date: 
2014-02-25
Grant time: 
684 days
Grant time percentile rank: 
12
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Coaxial needle atomizing system

Patent image
AECBC

An atomizing system tar generating an aerosol for inhalation research is disclosed. The atomizing system, in one embodiment, is capable of functioning efficiently at ultra-low liquid and low gas feed rates through the use of a 32 gauge feed line. This feed line reduces dead space in the atomizing system as well as the amount of highly toxic and/or expensive fluid needed to perform the research. An aerosol is generated in a consistent and repeatable manner by injecting fluid at a teed rate of 0.2-20 μl/min into a gas stream from a compressed gas source at a pressure of 30-60 psi. An adapter is used to connect a syringe containing the fluid to be tested to the 32 gauge feed line.

Inventors: 
Mccaskey, David A.
Patent Number: 
US9016671
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2013-03-12
Grant Date: 
2015-04-28
Grant time: 
777 days
Grant time percentile rank: 
14
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Micro UV detector

Patent image
AECBC

A biological aerosol detector is provided. The biological aerosol detector uses a semiconductor optical source with an ultraviolet emission band to excite biological molecules in an aerosol sample. Filtering optics are configured to attenuate radiation from a secondary emission band of the optical source to prevent false signals due to scattering of secondary emission band radiation from non-biological molecules. An intake/exhaust manifold that includes an intake pipe that fits within a concentric exhaust pipe is also provided. The intake/exhaust manifold planarizes the flow of the sampled aerosol to maximize the time of irradiation. An electrostatic sampling grid is also provided to selectively draw biological molecules having a net charge into the optical chamber.

Inventors: 
Sickenberger, David W.; Cabalo, Jerry B.; Sickenberger, Richard
Patent Number: 
US7375348
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2005-11-03
Grant Date: 
2008-05-20
Grant time: 
929 days
Grant time percentile rank: 
17
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Hair follicle bulb as a biodosimeter

Patent image
AECBC

The various embodiments provide method of using hair follicle bulbs as biodosimeters for the detection of chemical exposure. The methods described herein utilize intact, plucked hair follicle bulbs and can be used to monitor real-time or near real-time changes in the levels of specific follicular bulb biomarkers to determine exposure to toxicants. By utilizing the living, responsive cells in the plucked hair follicle bulb in an immunohistochemical (IHC) analysis, the various embodiments mitigate the risks of false positives associated with segmental hair analysis and avoid the more invasive collection required for serum and urinalysis.

Inventors: 
Sekowski, Jennifer W.; Chambers, Amanda E.
Patent Number: 
US7629129
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-04-26
Grant Date: 
2009-12-08
Grant time: 
1,322 days
Grant time percentile rank: 
24
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Infrared Mueller matrix acquisition and preprocessing system and method

Patent image
AECBC

An analog Mueller matrix data acquisition system (AMMS) acquiring middle-infrared Mueller (M) matrices of backscattering surfaces. The M-elements are measured by means of an active photopolarimetric sensor. The AMMS records nine M-elements simultaneously in groups of four modulo 2 incident continuous-wave CO2 laser beams—one incident beam is tuned to a fundamental molecular absorption cross-section by the aerosol of detection interest (analytic wavelength λa) while the other beam is detuned off that resonance band (reference wavelength λr) and in the closest vicinity to λa. Accordingly, those ΔM elements exhibiting susceptible behavior to the aerosol analyte, driven on-then-off its molecular vibrational resonance band, cues an identification event thus providing detection decision information. The AMMS is comprised of PEM reference frequency synthesizer, optical power regulation, data digitizer, and computer interface components in an interfaced and integrated framework that governs all operations of M-elements production by the photopolarimetric sensor.

Inventors: 
Carrieri, Arthur H.; Owens, David J.; Schultz, Jonathan C.
Patent Number: 
US7737399
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-10-23
Grant Date: 
2010-06-15
Grant time: 
600 days
Grant time percentile rank: 
10
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Orifice test device for protective mask testers

Patent image
AECBC

An orifice test calibration device tests the functionality of protective mask testers. The orifice test calibration device has a semi-rigid tubular channel with one end for sealing the flow outlet port of the protective mask tester and a second end for sealing the vacuum inlet port of the protective mask tester. The device also includes a sealable opening within the tubular channel and an insertable orifice plug having a set diameter for insertion into the sealable opening in order to calibrate the protective mask tester.

Inventors: 
Israel, Joshua D.; Piepenburg, Corey L.; Goodman, Malcolm D.
Patent Number: 
US7743647
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-08-21
Grant Date: 
2010-06-29
Grant time: 
677 days
Grant time percentile rank: 
12
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Apparatus for chemical detection training

Patent image
AECBC

Methods and apparatus for chemical warfare agent detection training are provided. More particularly, methods and apparatus are provided to simulate the detection of low volatility chemical warfare agents by simulating the use of currently fielded U.S. Army detection kits without exposure to hazardous agents. A simulant is disposed in a sample heating assembly. The sample heating assembly is placed over a detection window of a detector, and the simulant is heated in order to make a simulated detection.

Inventors: 
Genovese, James A.
Patent Number: 
US7749440
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-01-12
Grant Date: 
2010-07-06
Grant time: 
1,636 days
Grant time percentile rank: 
30
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Detecting bacteria by direct counting of structural protein units or pili by IVDS and mass spectrometry

Patent image
AECBC

A system and method for detecting the presence of submicron sized particles in a sample taken from the environment. More particularly, the system may be used to detect and identify bacteria by detecting the presence of bacterial pili which have been separated from bacterial cells in the sample. The system includes means for collecting a sample from the environment, separating pili from bacteria in the sample, and purifying and concentrating the submicron sized pili in the sample based on the size of the pili. The purified and concentrated pili are detected with an apparatus which includes an electrospray assembly having an electrospray capillary, a differential mobility analyzer which receives output from the capillary, and a condensation particle counting device for counting the number of pili sized particles that pass through the differential mobility analyzer.

Inventors: 
Wick, Charles H.
Patent Number: 
US8021884
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2010-12-09
Grant Date: 
2011-09-20
Grant time: 
285 days
Grant time percentile rank: 
5
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Methods and apparatus for chemical detection training

Patent image
AECBC

Methods and apparatus for chemical warfare agent detection training are provided. More particularly, methods and apparatus are provided to simulate the detection of low volatility chemical warfare agents by simulating the use of currently fielded U.S. Army detection kits without exposure to hazardous agents. A simulant is disposed in a sample heating assembly. The sample heating assembly is placed over a detection window of a detector, and the simulant is heated in order to make a simulated detection.

Inventors: 
Genovese, James A.
Patent Number: 
US8076150
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2010-06-30
Grant Date: 
2011-12-13
Grant time: 
531 days
Grant time percentile rank: 
9
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Photopolarimetric lidar dual-beam switching device and mueller matrix standoff detection system and method

Patent image
AECBC

An optomechanical switching device, a control system, and a graphical user interface for a photopolarimetric lidar standoff detection that employs differential-absorption Mueller matrix spectroscopy. An output train of alternate continuous-wave CO2 laser beams [ . . . L1:L2 . . . ] is directed onto a suspect chemical-biological (CB) aerosol plume or the land mass it contaminates (S) vis-à-vis the OSD, with L1 [L2] tuned on [detuned off] a resonant molecular absorption moiety of CB analyte. Both incident beams and their backscattered radiances from S are polarization-modulated synchronously so as to produce gated temporal voltage waveforms (scattergrams) recorded on a focus at the receiver end of a sensor (lidar) system. All 16 elements of the Mueller matrix (Mij) of S are measured via digital or analog filtration of constituent frequency components in these running scattergram data streams (phase-sensitive detection). A collective set of normalized elements {ΔMi,j} (ratio to M11) susceptible to analyte, probed on-then-off its molecular absorption band, form a unique detection domain that is scrutinized; i.e., any mapping onto this domain by incoming lidar data—by means of a trained neural network pattern recognition system for instance—cues a standoff detection event.

Inventors: 
Carrieri, Arthur H.; Roese, Erik S.; Owens, David J.; Schultz, Jonathan C.; Talbard, Michael V.; Lim, Pascal I.; Hung, Kevin C.; Bottiger, Jerold R.
Patent Number: 
US8164742
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2007-07-18
Grant Date: 
2012-04-24
Grant time: 
1,742 days
Grant time percentile rank: 
32
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Color changing polymer films for detecting chemical and biological targets

Patent image
AECBC

A sensor system, and a method of detecting a target analyte, comprises a chemically functionalized block copolymer, and a target analyte. The block copolymer exhibits a color change in the visible spectrum upon exposure to the target analyte.

Inventors: 
Kofinas, Peter; Ayyub, Omar B.; Sekowski, Jennifer W.; Yang, Ta-i
Patent Number: 
US9115240
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2012-05-31
Grant Date: 
2015-08-25
Grant time: 
1,181 days
Grant time percentile rank: 
21
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNIV MARYLAND

Vapor generator safety release device

Patent image
AECBC

A vapor generator safety relief device for use in a surety system includes a conical flask, manifold, bubbler, and relief valve. The manifold includes a first chamber for inlet gas and a second chamber for outlet gas. The first chamber comprises an inlet port, an inlet tube, and a relief valve housing. The second chamber comprises an outlet tube and an outlet port. The bubbler is confluent with the inlet tube and disposed within the flask.

Inventors: 
Matthews, Robin L.
Patent Number: 
US8191398
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2009-09-15
Grant Date: 
2012-06-05
Grant time: 
994 days
Grant time percentile rank: 
18
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Methods for detection and identification of cell type

Patent image
AECBC

A process is provided for identifying a cell type in a sample that includes identification of one or more peptide sequences in the sample. Each peptide sequence is assigned to a protein of known sequence. A matrix of assignments is generated for the presence or absence of each peptide in one or more cells. The matrix of assignments is rearranged according to cell classification. A cell type based on the most probable cell classification is identified.

Inventors: 
Wick, Charles H.; Stanford, Michael F.; Zulich, Alan W.; Deshpande, Samir V.; Jabbour, Rabih E.; Dworzanski, Jacek P.; Mccubbin, Patrick E.
Patent Number: 
US8224581
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2009-09-30
Grant Date: 
2012-07-17
Grant time: 
1,021 days
Grant time percentile rank: 
18
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Method and device for validating or calibrating a chemical detector at a point of use

Patent image
AECBC

A method for validating or calibrating a chemical detector at a point of use. The method includes presenting a device to the chemical detector, the device comprising a frangible container defining a predetermined volume and a chemical material sealed within the frangible container in a predetermined amount, and breaking the frangible container to release the chemical material for detection by the chemical detector. A device and method of making the device for validating or calibrating a chemical at a point of use are also provided.

Inventors: 
Chu, Pamela M.; Anderson, Jeffrey R.
Patent Number: 
US8347685
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2009-10-23
Grant Date: 
2013-01-08
Grant time: 
1,173 days
Grant time percentile rank: 
21
Claim count percentile rank: 
7
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US COMMERCE

Methods for detection and identification of cell type

Patent image
AECBC

A process is provided for identifying a cell type in a sample that includes identification of one or more peptide sequences in the sample. Each peptide sequence is assigned to a protein of known sequence. A matrix of assignments is generated for the presence or absence of each peptide in one or more cells. The matrix of assignments is rearranged according to cell classification. A cell type based on the most probable cell classification is identified.

Inventors: 
Wick, Charles H.; Stanford, Michael F.; Zulich, Alan W.; Deshpande, Samir V.; Jabbour, Rabih E.; Dworzanski, Jacek P.; Mccubbin, Patrick E.
Patent Number: 
US8412464
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2012-07-11
Grant Date: 
2013-04-02
Grant time: 
265 days
Grant time percentile rank: 
4
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Dilution and sampling system

Patent image
AECBC

A system for testing the efficiency of a test HEPA filter, the system comprises a dilution system and a sampling system. The dilution system processes samples collected upstream of the test HEPA filter. The dilution system has a test portion and a calibrated portion. The calibrated portion aids in determining the dilution ratio of the test portion thereby rendering the dilution system self-calibrating. The sampling system receives upstream samples via the dilution system, and downstream samples collected directly downstream of the test HEPA filter. The sampling system incorporates a flow rate balancing system to ensure accurate counts with respect to samples collected upstream and downstream of the test HEPA filter. The sampling system works well with particle counters fitted with relatively weak fans to draw in samples for counting; this is achieved by connecting the sampling system to both the inlet and exhaust outlet of a particle counter.

Inventors: 
Mancinho, Derek J.; Win, Myat S.
Patent Number: 
US8813582
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2012-05-17
Grant Date: 
2014-08-26
Grant time: 
831 days
Grant time percentile rank: 
15
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Sampling and counting system

Patent image
AECBC

A system for testing the efficiency of a test HEPA filter, the system comprises a dilution system and a sampling system. The dilution system processes samples collected upstream of the test HEPA filter. The dilution system has a test portion and a calibrated portion. The calibrated portion aids in determining the dilution ratio of the test portion thereby rendering the dilution system self-calibrating. The sampling system receives upstream samples via the dilution system, and downstream samples collected directly downstream of the test HEPA filter. The sampling system incorporates a flow rate balancing system to ensure accurate counts with respect to samples collected upstream and downstream of the test HEPA filter. The sampling system works well with particle counters fitted with relatively weak fans to draw in samples for counting; this is achieved by connecting the sampling system to both the inlet and exhaust outlet of a particle counter.

Inventors: 
Mancinho, Derek J.; Win, Myat S.
Patent Number: 
US8875589
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2012-05-17
Grant Date: 
2014-11-04
Grant time: 
901 days
Grant time percentile rank: 
16
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Simulated explosive composition

Patent image
AECBC

The present invention can be characterized as a trainer kit for a Colorimetric Reconnaissance Explosive Squad Screening (“CRESS”) kit, which contains a control compound and a set of simulated explosive compositions (“SEC”). The control compound contains no explosive precursor, while each SEC is a combination of one or more explosive precursors that is to be detected by CRESS, and at least one non-explosive additive that reduces the kinetics of the explosive precursor. The SEC retains the colorimetric characteristics of the explosive precursor, but is stable in heat and non-hazardous.

Inventors: 
Genovese, James A.; Labonte, Amee W.; Domanico, Joseph A.; Kauzlarich, Michael F.
Patent Number: 
US9046508
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2013-03-14
Grant Date: 
2015-06-02
Grant time: 
810 days
Grant time percentile rank: 
14
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Fixture for system-level glove testing of contact permeation

Patent image
AECBC

A system and method for testing contact permeation of a glove using a mannequin hand having fingers and a thumb. A hand cradle supports the mannequin hand with the palm of the hand facing away from the hand cradle. A patterned weight block applies pressure to the palm, fingers, and thumb of the hand. A weight block is placed on the patterned weight block and the whole assembly is placed in an air tight containment box. The mannequin hand is covered with a protection layer, a sorptive glove layer, and a test glove. The test glove is contaminated with the chemical of interest. Pressure is applied to the palm, fingers, and thumb of the test glove, and the contaminant that permeates through the test glove into the sorptive glove layer is collected and measured.

Inventors: 
D'onofrio, Terrence G.; Wallace III, Richard D.; Maciver, Brian K.
Patent Number: 
US9086351
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2013-03-14
Grant Date: 
2015-07-21
Grant time: 
859 days
Grant time percentile rank: 
15
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

External filter assembly adapted for modifying a suction cleaning device to perform biological sampling

Patent image
AECBC

An external filter assembly adapted for modifying a suction cleaning device to sample relatively small particles from various surfaces and/or the ambient air, includes a housing having a first open end, a second open end and a throughbore between the first and second open ends, a filter adapted for capturing particles with particle sizes greater than 0.1 micrometer, the filter being mounted on and enclosing the first open end, and means for securely retaining the second open end of the housing on an exhaust port of the suction cleaning device in communication with the housing throughbore.

Inventors: 
Bottiger, Jerold R.; Kesavan, Jana S.
Patent Number: 
US9097624
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2013-03-01
Grant Date: 
2015-08-04
Grant time: 
886 days
Grant time percentile rank: 
16
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Disseminated vapor capture device

Patent image
AECBC

A disseminated vapor capture device for challenging a gas sampling apparatus with a vapor stream, includes an inlet being adapted for connection to a vapor generating apparatus producing a vapor stream containing target particles or analytes, an outer shell enclosing an inner chamber in communication with the inlet, the inner chamber being adapted for passing the vapor stream therethrough, an outlet being adapted for connection to a vacuum source, the outlet being in communication with the inner chamber for passing the vapor stream out of the inner chamber, and at least one sampling port in communication with the inner chamber, the at least one sampling port each being configured for coupling engagement with a gas sampling apparatus.

Inventors: 
Hughes, Thomas M.; Ong, Kwok Y.
Patent Number: 
US9279748
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2013-10-17
Grant Date: 
2016-03-08
Grant time: 
873 days
Grant time percentile rank: 
16
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Apparatus for testing vapor emissions from materials

Patent image
AECBC

An apparatus comprising a dynamic vapor microchamber having a recessed area that accommodates a test material that includes chemical vapors emitted therefrom; an air inlet chamber that directs a flow of air towards the recessed area; at least one air flow wall adjacent to the recessed area and intersecting the flow of air, wherein the at least one air flow wall disrupts the air flow field as it flows towards the test material and produces a uniform and distributed laminar air flow field across a surface of the test material; a thermal controller under the recessed area that maintains a uniform temperature of the test material and the flow of air over the test material; and an air exhaust port that collects the vapors emitted from the test material. The apparatus may include a plurality of chambers arranged adjacent to one another.

Inventors: 
Lalain, Theresa A.; Mantooth, Brent A.; Piepenburg, Corey L.
Patent Number: 
US9347860
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2014-01-28
Grant Date: 
2016-05-24
Grant time: 
847 days
Grant time percentile rank: 
15
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Plastic particle detector for detection of biological aerosol and other fluorescent materials

Patent image
AECBC

A plastic particle detector for detecting biological and other fluorescent materials is disclosed. The detector detects the fluorescence and scattering signals from these materials using deep UV excitation. The detector is fabricated using plastic materials and exploits the properties of lower manufacturing costs, lower materials costs, light weight, ruggedness and assembly ease offered by plastics, while eliminating stray fluorescence signals ordinarily generated by plastic materials.

Inventors: 
Goad, Aime P.; Sickenberger, David W.; Narayanan, Fiona E.; Kreis, Richard J.; Strauch III, Lester D.; Kilper, Gary K.; Cabalo, Jerry B.; Wylie, Harold S.; Wong, Anna
Patent Number: 
US9500591
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2015-04-03
Grant Date: 
2016-11-22
Grant time: 
599 days
Grant time percentile rank: 
10
Claim count percentile rank: 
7
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Hand-held device with reagents and method for detection and diagnostics

Patent image
AECBC

A hand-held device and method of processing a biological threat agent sample such that any infectious organism is rendered harmless while preserving it for subsequent testing, the method comprising placing a sample comprising a biological threat agent in a reservoir; adding a first reagent comprising peracetic acid in sufficient concentration to reach a predetermined minimal concentration after mixing with the sample in the reservoir; inactivating the sample upon interaction of the sample with the first reagent for a predetermined period of time at a predetermined temperature; removing the inactivated sample from the reservoir; and providing the inactivated sample for subsequent diagnostic testing, wherein the subsequent diagnostic testing is unaffected by inactivation of the sample. In another embodiment, the first reagent comprises a cupric salt, which is mixed with ascorbic acid and hydrogen peroxide to generate cupric ascorbate.

Inventors: 
Sagripanti, Jose Luis
Patent Number: 
US9063046
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2014-02-19
Grant Date: 
2015-06-23
Grant time: 
489 days
Grant time percentile rank: 
8
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Aerosol generator

Patent image
AECBC

An aerosol generator includes a saturator having an enclosure for passing a gas therethrough, and a porous substrate being adapted for retaining a non-vaporized form of an aerosol material, wherein the porous substrate is further adapted to release a vaporized form of the aerosol material for introduction into the gas within the enclosure, and a condenser adapted for receiving the gas containing the vapor from the saturator to produce an aerosol containing the aerosol material.

Inventors: 
Carpin, John C.
Patent Number: 
US8177199
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2009-09-30
Grant Date: 
2012-05-15
Grant time: 
958 days
Grant time percentile rank: 
17
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Closed-loop waste disposal system for enhanced safety

Patent image
AECBC

A system and method to safely dispose of hazardous liquid waste includes a glove box for conducting a test with a hazardous liquid material therein, the glove box having a drainage line connected to a waste tank for directing the hazardous liquid waste from the glove box to the waste tank. A waste disposal line and an air vent line are connected between the waste tank and a waste container. Double-valved connectors are positioned in the waste disposal line and in the air vent line allowing the liquid waste and air to flow between the waste tank and a waste container when the double-valved connectors are coupled together. When the double-valved connectors are uncoupled, both the waste tank and the waste container are completely sealed to the surrounding environment.

Inventors: 
D'onofrio, Terrence G.; Noya, George; Faure, Luis Enrique
Patent Number: 
US8337776
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2012-04-10
Grant Date: 
2012-12-25
Grant time: 
259 days
Grant time percentile rank: 
4
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Catalytic buffering systems

Patent image
AECBC

Compositions and methods for catalytic buffering of enzymatic decontamination reactions are provided. Enzymatic decontamination of organophosphorus or organohalogen compounds generates acidic reaction products that precipitously reduce the pH of the medium, thus impairing activity of the decontaminating enzymes. Catalytic buffering, that is, the use of an enzyme to produce ions from a substrate to modulate pH, can provide effective pH control. The compositions provided here include urease enzymes with mutations in the alpha subunit of the urease holoenzyme. These mutant ureases maintain urease activity in the presence of fluoride ions, which are organophosphorus and organohalogen hydrolysis products that otherwise inhibit urease activity. The fluoride-resistant ureases act as effective catalytic buffers during organofluorophosphorus hydrolysis reactions. Methods for using the fluoride-resistant ureases in enzymatic decontamination are also provided. Catalytic buffering afforded by fluoride-resistant ureases facilitates the application of safe and effective enzymatic methods for decontamination of personnel, equipment and the environment.

Inventors: 
Fry, Ilona J.; Defrank, Joseph J.
Patent Number: 
US7704724
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-01-26
Grant Date: 
2010-04-27
Grant time: 
1,552 days
Grant time percentile rank: 
28
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Artificial chimeras engineered to simulate multiple biological threat agents

Patent image
AECBC

This invention provides safe, non-infectious chimeras that include the nucleic acid signature of most bacterial and viral biological threat agents. These chimeras mimic properties of threat agents and are useful as simulants to develop, evaluate, test, and train on nucleic acid-based biodetectors and diagnostic products of interest in biodefense, without the need for accessing or producing virulent agents.

Inventors: 
Sagripanti, Jose-luis; Carrera, Monica
Patent Number: 
US7790452
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-07-22
Grant Date: 
2010-09-07
Grant time: 
777 days
Grant time percentile rank: 
14
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Methods for determining the presence of staphylococcal enterotoxin A gene in a sample

Patent image
AECBC

The present invention relates to methods and assays for determining the presence of staphylococcal enterotoxin A in a sample through detection of a nucleic acid encoding staphylococcal enterotoxin A.

Inventors: 
Cao, Cheng J.; Khan, Akbar S.; O'connell, Kevin P.; Bucher, Jennifer R.; Gostomski, Mark V.; Valdes, James J.
Patent Number: 
US7642082
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2003-07-28
Grant Date: 
2010-01-05
Grant time: 
2,353 days
Grant time percentile rank: 
43
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Artificial chimeras engineered to simulate multiple biological threat agents

Patent image
AECBC

This invention provides safe, non-infectious chimeras that include the nucleic acid signature of most bacterial and viral biological threat agents. These chimeras mimic properties of threat agents and are useful as simulants to develop, evaluate, test, and train on nucleic acid-based biodetectors and diagnostic products of interest in biodefense, without the need for accessing or producing virulent agents.

Inventors: 
Sagripanti, Jose-luis; Carrera, Monica
Patent Number: 
US7910365
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2010-08-31
Grant Date: 
2011-03-22
Grant time: 
203 days
Grant time percentile rank: 
3
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Simultaneous detection of biological agents by solid-state hybridization and naked eye visualization

Patent image
AECBC

The invention relates to methods and products simultaneously enabling detection of several biological threat agents, including viruses and bacteria, during a combat situation or in any suspected contamination situation.

Inventors: 
Sagripanti, Jose-luis
Patent Number: 
US7838227
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-10-12
Grant Date: 
2010-11-23
Grant time: 
1,503 days
Grant time percentile rank: 
27
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Amino acid sites in Flavivirus E proteins useful for development of diagnostics and vaccines

Patent image
AECBC

Highly immunoreactive viral peptides are disclosed which are derived from the E protein of major groups of the Flavivirus genus by computational analyses. These peptides are used in reliable diagnostic methods for the detection and diagnosis of Flavivirus, detecting the presence of antibodies against Flavivirus, and to form vaccine composition(s) for the prevention of Flavivirus infections in humans.

Inventors: 
Sagripanti, Jose-luis; Mazumder, Raja; Wu, Cathy Huey-hwa
Patent Number: 
US7943148
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-04-02
Grant Date: 
2011-05-17
Grant time: 
1,140 days
Grant time percentile rank: 
20
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Rapid and sensitive method to measure endonuclease activity

Patent image
AECBC

A rapid and sensitive method to measure endonuclease activity comprising reacting a substrate suspected of having endonuclease activity with a synthetic nucleotide to induce endonuclease cleavage of the synthetic nucleotide followed by measurement of activity by carrying out a polymerase chain reaction (PCR). When no polymerase chain reaction takes place when carrying out the method it is indicative of no endonuclease activity in the substrate. Synthetic oligonucleotides, primers, and probes useful for carrying out the method are disclosed.

Inventors: 
Dorsey, Russell M.; Dorsey, Robert W.
Patent Number: 
US8129149
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-11-12
Grant Date: 
2012-03-06
Grant time: 
1,210 days
Grant time percentile rank: 
22
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Artificial chimeras engineered to simulate multiple biological threat agents

Patent image
AECBC

This invention provides safe, non-infectious chimeras that include the nucleic acid signature of most bacterial and viral biological threat agents. These chimeras mimic properties of threat agents and are useful as simulants to develop, evaluate, test, and train on nucleic acid-based biodetectors and diagnostic products of interest in biodefense, without the need for accessing or producing virulent agents.

Inventors: 
Sagripanti, Jose-luis; Carrera, Monica
Patent Number: 
US7993844
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2010-09-01
Grant Date: 
2011-08-09
Grant time: 
342 days
Grant time percentile rank: 
6
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Non-wild-type organophosphorus acid anhydrolases for enzymatic decontamination

Patent image
AECBC

Provided are non-wild-type organophosphorus acid anhydrolases that are capable of degrading (ethyl {2-[bis(propan-2-yl)amino]ethyl}sulfanyl) (methyl)phosphinate and other V-agents. Particular embodiments include an organophosphorus acid anhydrolase including an amino acid substitution at position 212.

Inventors: 
Shah, Saumil S.; Guelta, Mark A.; Harvey, Steven P.
Patent Number: 
US9017982
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2013-12-17
Grant Date: 
2015-04-28
Grant time: 
497 days
Grant time percentile rank: 
9
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Puumala virus full-length M segment-based DNA vaccines

Patent image
AMRMC

The invention contemplates a new synthetic, codon-optimized Puumala virus (PUUV) full-length M gene open reading frame (ORF) that encodes a unique consensus amino acid sequence. The PUUV ORF was cloned into a plasmid to form the first stable PUUV full-length M gene that elicits neutralizing antibodies. The gene can be engineered into a molecular vaccine system, and is useful to protect mammals against infection with Puumala virus.

Inventors: 
Hooper, Jay
Patent Number: 
US8183358
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-02-12
Grant Date: 
2012-05-22
Grant time: 
1,561 days
Grant time percentile rank: 
28
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Submersible portable in-situ automated water quality biomonitoring apparatus and method

Patent image
AMRMC

A submersible biomonitoring system for monitoring water quality in situ includes a submersible chamber constructed of a di-electric material and sized to allow suitable signals from one or more aquatic organisms to be received by eliminating cross-talk between cells while allowing ambient conditions to be maintained inside the chamber. The aquatic organism exhibits ventilatory behavior and body movement sensitive to water quality which manifest as electrical signals picked up by electrodes and communicated to a pre-amplifier that conditions the signals for communication to a land-based amplifier and/or controller that is used to interpret the signals to determine when the water to which the organism is exposed has caused physiological stress to the organism.

Inventors: 
Widder, Mark W.; Shedd, Tommy R.; Brown, Mark W.; Swanson, Murray S.
Patent Number: 
US7702473
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2007-04-17
Grant Date: 
2010-04-20
Grant time: 
1,099 days
Grant time percentile rank: 
20
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Human liver cell line

Patent image
AMRMC

In this application is described the establishment and maintanence of a normal human hepatocyte cell line able to support complete development of malaria parasite development in vitro. Advantages and uses of the cell line are also described.

Inventors: 
Prachumsri, Jetsumon; Yimamnuaychok, Nongnuch
Patent Number: 
US7015036
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2001-09-25
Grant Date: 
2006-03-21
Grant time: 
1,638 days
Grant time percentile rank: 
30
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Direct quantification of ribosome inactivating protein

Patent image
AECBC

A method for detecting ribosome inactivating protein (RIP) activity in a sample is provided that involves contacting a sample that contains an RIP with an inventive substrate that is depurinated to form product. The product is hybridized to a template and cleaved by an apurinic/apyrimidinic endonuclease such that releasing the blocked 3′ end only in a sample that contains RIP activity. The 5′ end of the product serves as a primer for extension by a polymerase reaction. The newly synthesized strand complementary to the template is detected by RT-PCR processes. A kit is provided suitable for field or laboratory use.

Inventors: 
Dorsey, Russell M.
Patent Number: 
US7745136
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2009-01-30
Grant Date: 
2010-06-29
Grant time: 
515 days
Grant time percentile rank: 
9
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Artificial chimeras engineered to simulate multiple biological threat agents

Patent image
AECBC

This invention provides safe, non-infectious chimeras that include the nucleic acid signature of most bacterial and viral biological threat agents. These chimeras mimic properties of threat agents and are useful as simulants to develop, evaluate, test, and train on nucleic acid-based biodetectors and diagnostic products of interest in biodefense, without the need for accessing or producing virulent agents.

Inventors: 
Sagripanti, Jose-luis; Carrera, Monica
Patent Number: 
US8017330
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2010-09-01
Grant Date: 
2011-09-13
Grant time: 
377 days
Grant time percentile rank: 
6
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Expression, purification and uses of a plasmodium falciparum liver stage antigen 1 polypeptide

Patent image
AMRMC

In this application is described the expression and purification of a recombinant Plasmodium falciparum (3D7) LSA-NRC polypeptide. The method of the present invention produces a highly purified polypeptide which is useful as a vaccine and as a diagnostic reagent.

Inventors: 
Lanar, David E.; Hillier, Collette J.; Lyon, Jeffrey A.; Angov, Evelina; Kumar, Sanjai; Rogers, William; Barbosa, Arnoldo
Patent Number: 
US8268615
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2009-05-14
Grant Date: 
2012-09-18
Grant time: 
1,223 days
Grant time percentile rank: 
22
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Methods for detecting Venezuelan equine encephalitis virus TC-83 and its use as a biological agent simulant

Patent image
AECBC

The present invention is generally related to products and methods that facilitate the use of Venezuelan equine encephalitis (VEE) virus TC-83 (TC-83) as a non-hazardous simulant, or surrogate, for viable pathogenic viruses. Specifically, TC-83 nucleic sequences are used in a method of detecting VEE or TC-83 in a sample thought to contain a biological threat agent. TC-83 and its nucleic acid sequence may therefore be used in the research, development, testing, evaluation, and training for technologies that enable the detection of biological threat agents. More particularly, specific primers and probes may be used to verify that instruments and systems using PCR detection methods are functioning properly.

Inventors: 
Horsmon, Jennifer R.; O'connell, Kevin P.
Patent Number: 
US8168386
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-01-09
Grant Date: 
2012-05-01
Grant time: 
1,574 days
Grant time percentile rank: 
28
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA

Direct quantification of ribosome inactivating protein

Patent image
AECBC

A method for detecting ribosome inactivating protein (RIP) activity in a sample is provided that involves contacting a sample that contains an RIP with an inventive substrate that is depurinated to form product. The product is hybridized to a template and cleaved by an apurinic/apyrimidinic endonuclease such that releasing the blocked 3′ end only in a sample that contains RIP activity. The 5′ end of the product serves as a primer for extension by a polymerase reaction. The newly synthesized strand complementary to the template is detected by RT-PCR processes. A kit is provided suitable for field or laboratory use.

Inventors: 
Dorsey, Russell M.
Patent Number: 
US8188257
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2010-06-28
Grant Date: 
2012-05-29
Grant time: 
701 days
Grant time percentile rank: 
12
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Method for simultaneously detecting multiple biological threat agents

Patent image
AECBC

A multiplex PCR assay for simultaneously detecting biological threat agents whose genome is DNA or RNA, by using computational tools to identify a specific target sequence which is unique to a specific genus or species of organism and is also a conserved sequence within that group, selecting specific primer sets, creating a probe to label the target nucleic acid, extracting the target nucleic acid from a sample, amplifying the targeted nucleic acid to detectible levels and reading the presence or absence of the target nucleic acid simultaneously from all threat agents.

Inventors: 
Sagripanti, Jose-luis; Zandomeni, Monica Carrera
Patent Number: 
US8367327
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-05-21
Grant Date: 
2013-02-05
Grant time: 
1,721 days
Grant time percentile rank: 
31
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Plug flow reactor process for anaerobic cellulosic ethanol

Patent image
AECBC

The present invention is generally related to systems and methods to permit the growth of anaerobic, ethanol-producing bacteria using pretreated biomass such as cellulose in a manner to facilitate the efficient conversion of cellulose to ethanol.

Inventors: 
Harvey, Steven P.
Patent Number: 
US8809042
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-10-19
Grant Date: 
2014-08-19
Grant time: 
1,035 days
Grant time percentile rank: 
19
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Hand-held device with reagents and method for detection and diagnostics

Patent image
AECBC

A hand-held device and method of processing a biological threat agent sample such that any infectious organism is rendered harmless while preserving it for subsequent testing, the method comprising placing a sample comprising a biological threat agent in a reservoir; adding a first reagent comprising peracetic acid in sufficient concentration to reach a predetermined minimal concentration after mixing with the sample in the reservoir; inactivating the sample upon interaction of the sample with the first reagent for a predetermined period of time at a predetermined temperature; removing the inactivated sample from the reservoir; and providing the inactivated sample for subsequent diagnostic testing, wherein the subsequent diagnostic testing is unaffected by inactivation of the sample. In another embodiment, the first reagent comprises a cupric salt, which is mixed with ascorbic acid and hydrogen peroxide to generate cupric ascorbate.

Inventors: 
Sagripanti, Jose Luis
Patent Number: 
US9061085
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2014-02-19
Grant Date: 
2015-06-23
Grant time: 
489 days
Grant time percentile rank: 
8
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Isolation and purification of <i>P. falciparum </i>merozoite protein-142 vaccine

Patent image
AMRMC

In this application is the expression and purification of a recombinant Plasmodium falciparum (3D7) MSP-142. The method of the present invention produces a highly purified protein which retains folding and disulfide bridging of the native molecule. The recombinant MSP-142 is useful as a diagnostic reagent, for use in antibody production, and as a vaccine.

Inventors: 
Lyon, Jeffrey A.; Angov, Evelina
Patent Number: 
US8298546
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2009-09-29
Grant Date: 
2012-10-30
Grant time: 
1,127 days
Grant time percentile rank: 
20
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Isolation and purification of <i>P. falciparum </i>merozoite protein-142 vaccine

Patent image
AMRMC

In this application is the expression and purification of a recombinant Plasmodium falciparum (3D7) MSP-142. The method of the present invention produces a highly purified protein which retains folding and disulfide bridging of the native molecule. The recombinant MSP-142 is useful as a diagnostic reagent, for use in antibody production, and as a vaccine.

Inventors: 
Lyon, Jeffrey A.; Angov, Evelina
Patent Number: 
US7595191
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2005-01-24
Grant Date: 
2009-09-29
Grant time: 
1,709 days
Grant time percentile rank: 
31
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Extraneous DNA sequence that facilitates hantavirus gene expression

Patent image
AMRMC

In this application is described a protective DNA vaccines against infection with HFRS- and HPS-associated hantaviruses. The vaccines were constructed by subcloning cDNA representing the medium (M) (encoding the G1 and G2 glycoproteins) into the DNA expression vector pWRG7077. Animals vaccinated with the M construct developed a neutralizing antibody response. Passive transfer experiments show that serum from vaccinated animals, when injected on days 4 or 5 after challenge, protected animals from lethal disease.

Inventors: 
Hooper, Jay W.; Schmaljohn, Connie S.; Custer, Max
Patent Number: 
US7217812
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2003-03-21
Grant Date: 
2007-05-15
Grant time: 
1,516 days
Grant time percentile rank: 
27
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Fish hatching method and apparatus

Patent image
AMRMC

The invention is a method and kit for conducting a rapid toxicity test. Methods and kits according to the invention include an animal or plant species in diapause.

Inventors: 
Shedd, Tommy R.; Widder, Mark W.; Hull, Eugene
Patent Number: 
US7094417
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2003-06-05
Grant Date: 
2006-08-22
Grant time: 
1,174 days
Grant time percentile rank: 
21
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Method of treating organophosphorous poisoning

Patent image
AMRMC

A method of treating organophosphorous (OP) poisoning comprising administering to a mammal at risk for OP poisoning an OP poisoning-inhibiting amount of galantamine.

Inventors: 
Albuquerque X, Edson; Adler, Michael; Pereira, Edna F. R.
Patent Number: 
US7888346
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2005-09-23
Grant Date: 
2011-02-15
Grant time: 
1,971 days
Grant time percentile rank: 
36
Claim count percentile rank: 
3
Citations percentile rank: 
3
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Artemisinins in the clinical and veterinary management of kinetoplastid infections

Patent image
AMRMC

The invention relates to the treatment of kintoplastid infections by administering a pharmaceutical composition containing an extract from the plant Artemisia annua. The invention also relates to isolated, semi-synthetic and synthetic artemisinins that show improved efficacy in treating kinetoplastid infections. This invention also relates to a method of treating kintoplastid infections with artelinic acid and artemisinins and where Artelinic acid is administered orally.

Inventors: 
Kubata, Bruno K.; Martin, Samuel K.; Milhous, Wilbur K.
Patent Number: 
US8715751
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2009-07-16
Grant Date: 
2014-05-06
Grant time: 
1,755 days
Grant time percentile rank: 
32
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Plasmodium falciparum circumsporozoite vaccine gene optimization for soluble protein expression

Patent image
AMRMC

The present invention provides novel nucleotide sequence and other constructs used for expression of novel recombinant P. falciparum circumsporozoite proteins in bacterial cells such as E. coli. Processes are provided for producing a soluble recombinant P. falciparum CSP from E. coli. Methods to produce a human-grade, highly immunogenic anti-malaria vaccine based on CSP are shown. The novel recombinant P. falciparum circumsporozoite protein by itself or in combination with other malaria antigens or adjuvants can form the basis of an effective malaria vaccine.

Inventors: 
Dutta, Sheetij
Patent Number: 
US9115205
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-10-18
Grant Date: 
2015-08-25
Grant time: 
1,407 days
Grant time percentile rank: 
25
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Methods for the formulation and manufacture of artesunic acid for injection

Patent image
AMRMC

A method for the manufacture of a sterile intravenous or intramuscular formulation of artesunic acid and the formulation are the subject of this invention. First the artesunic acid powder is sterilized with ethylene oxide and placed into a sterile container. The contained sterilized powder is then dissolved in sterile sodium phosphate buffered solution to produce an injectable intravenous or intramuscular formulation. The sodium phosphate dissolves and dilutes the artesunic acid powder without caking or frothing resulting in an improved drug product. The invention also relates to the formulation and a method of treating a patient with either uncomplicated or severe and complicated malaria.

Inventors: 
Ellis, William Y.; Lim, Peter; Maniar, Manaj
Patent Number: 
US7956086
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2010-02-04
Grant Date: 
2011-06-07
Grant time: 
488 days
Grant time percentile rank: 
8
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Oral or intranasal vaccines using hydrophobic complexes having proteosomes and lipopolysaccharides

Patent image
AMRMC

An immunogenic complex, essentially consisting of neisserial outer membrane protein proteosomes hydrophobically complexed to native purified bacterial lipopolysaccaride and formulated in accordance with the current invention for mucosal delivery such as via the oral or intranasal route is used as a vaccine. Specifically, a vaccine using shigella lipopolysaccharides complexed to proteosomes for such mucosal administration induces IgG and IgA antibodies in sera and in respiratory and intestinal fluids. Furthermore, such antibodies are associated with protection against shigella infection and these vaccines are herein demonstrated to protect against mucosal infection with shigella.

Inventors: 
Lowell, George H.
Patent Number: 
US7112332
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
1992-10-08
Grant Date: 
2006-09-26
Grant time: 
5,101 days
Grant time percentile rank: 
86
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Vaccine against Gram-negative bacterial infections

Patent image
AMRMC

A vaccine, effective in inducing the production of antibodies with which to immunize a second subject passively against infection by Gram-negative bacteria and LPS-mediated pathology, comprises a non-covalent polyvalent complex formed between purified, detoxified LPS derived from E. coli and purified outer membrane protein derived from N. meningitidis. The same vaccine will also actively immunize a host subject against Gram-negative bacterial infections and LPS-mediated pathology. Meningococcal infections are included among those Gram-negative bacterial infections protected against by the vaccine.

Inventors: 
Bhattacharjee, Apurba; Cross, Alan; Sadoff, Jerald; Zollinger, Wendell
Patent Number: 
US7025963
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
1995-06-06
Grant Date: 
2006-04-11
Grant time: 
3,962 days
Grant time percentile rank: 
71
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Antiviral compounds and methods of using thereof

Patent image
AMRMC

Disclosed herein are compounds which exhibit antiviral activity against a plurality of viruses belonging to different families such as Bornaviridae, Filoviridae, Paramyxoviridae, Rhabdoviridae, Arenaviridae, Bunyaviridae, Orthomyxoviridae, and Poxviridae. Thus, methods of preventing, inhibiting, or reducing the viral activity of various viruses are provided as well as methods of treating viral infections.

Inventors: 
Aman, Mohammad Javad; Bavari, Sina; Burnett, James C.; Warfield, Kelly Lyn
Patent Number: 
US7999001
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-01-14
Grant Date: 
2011-08-16
Grant time: 
1,310 days
Grant time percentile rank: 
24
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Tissue graft with non-aligned fiber matrix retains mesenchymal progenitor cells on the non-injury-facing side

Patent image
AMRMC

A graft containing a scaffold that includes a matrix in which are positioned mesenchymal progenitor cells (MPCs) has the capacity to substantially improve wound healing, including wounds resulting from injury to nerve, bone and vascular tissue. MPCs can be harvested from debrided muscle tissue following orthopaedic trauma. The traumatized muscle-derived progenitor cells are a readily available autologous cell source that can be utilized to effect or improve wound healing in a variety of therapeutic settings and vehicles.

Inventors: 
Jackson, Wesley M.; Nesti, Leon J.; Tuan, Rocky S.
Patent Number: 
US8652458
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2009-08-05
Grant Date: 
2014-02-18
Grant time: 
1,658 days
Grant time percentile rank: 
30
Claim count percentile rank: 
7
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Nucleic acids containing a synthetic codon-optimized Sin Nombre virus full-length M gene

Patent image
AMRMC

The invention contemplates a new synthetic, codon-optimized Sin Nombre virus (SNV) full-length M gene open reading frame (ORF) that encodes a unique consensus amino acid sequence. The SNV ORF was cloned into a plasmid to form the first stable recombinant SNV full-length M gene that elicits neutralizing antibodies. The gene can be engineered into a vaccine system, and is useful to protect mammals against infection with Sin Nombre virus.

Inventors: 
Hooper, Jay
Patent Number: 
US9315826
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-01-31
Grant Date: 
2016-04-19
Grant time: 
1,905 days
Grant time percentile rank: 
35
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
GOVERNMENT OF THE UNITED STATES AS REP BY SECY OF THE ARMY FOR US ARMY MEDICAL RES INST

Combinations of gene deletions for live attenuated shigella vaccine strains

Patent image
AMRMC

Shigella vaccine strains whose primary attenuating feature is deletion of the virG(icsA) gene and additional two or more deletions in setAB(shET1), senA(shET2), senB(shET2-2), stxAB, and msbB2 genes. Thus, the vaccine strain will have three or more deletions in the identified genes, will be safer, and will reduce or eliminate symptoms of fever and diarrhea in humans. The following specific vaccine strains have been constructed: WRSS3 (ΔsenA, ΔsenB, ΔvirG, ΔmsbB2), WRSf2G15 (ΔvirG, ΔsetAB, ΔsenA, ΔsenB, ΔmsbB2), and WRSd5 (ΔvirG, ΔstxAB, ΔsenA, ΔsenB, ΔmsbB2).

Inventors: 
Venkatesan, Malabi; Ranallo, Ryan; Barnoy, Shoshana
Patent Number: 
US9320789
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2015-02-23
Grant Date: 
2016-04-26
Grant time: 
428 days
Grant time percentile rank: 
7
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Substituted triazines for malaria treatment and chemoprophylaxis

Patent image
AMRMC

Disclosed herein are triazine compounds and methods of making and using thereof to treat malaria, provide chemoprophylaxis, and/or treat or inhibit infection by one or more Plasmodium spp.

Inventors: 
Sciotti, Richard J.; Reichard, Gregory A.; Pannone, Kristina M.; Zottig, Victor E.
Patent Number: 
US9334246
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2014-03-13
Grant Date: 
2016-05-10
Grant time: 
789 days
Grant time percentile rank: 
14
Claim count percentile rank: 
7
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Method and system for predicting human cognitive performance

Patent image
AMRMC

An apparatus and a method for predicting cognitive performance of an individual based on factors including preferably sleep history and the time of day. The method facilitates the creation of predicted cognitive performance curves that allow an individual to set his/her sleep times to produce higher levels of cognitive performance. The method also facilitates the reconstruction of past cognitive performance levels based on sleep history.

Inventors: 
Balkin, Thomas J.; Belenky, Gregory L.; Hall, Stanley W.; Kamimori, Gary H.; Redmond, Daniel P.; Sing, Helen C.; Thomas, Maria L.; Thorne, David R.; Wesensten, Nancy Jo
Patent Number: 
US7766827
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2004-01-15
Grant Date: 
2010-08-03
Grant time: 
2,392 days
Grant time percentile rank: 
44
Claim count percentile rank: 
4
Citations percentile rank: 
3
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

System for providing servo-controlled resuscitation

Patent image
AMRMC

The present invention provides a system and method for controlling resuscitation in a patient. In at least one embodiment, the invention includes a fluid rate measurer, a controller electrically coupled to the fluid rate measurer, and a pump. The controller is adapted to receive signals from a physiological monitor and controls the pump.

Inventors: 
Sondeen, Jill L.; Drew, Guy A.
Patent Number: 
US8409130
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2004-09-08
Grant Date: 
2013-04-02
Grant time: 
3,128 days
Grant time percentile rank: 
57
Claim count percentile rank: 
7
Citations percentile rank: 
3
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Modular prosthetic foot

Patent image
AMRMC

A modular prosthetic foot includes an ankle component; a forefoot component having a circular part with a rounded top surface and at least one flat side surface, the circular part being connected to a rear part of the forefoot component; a forefoot cushion bumper positioned around the circular part; and a heel component.

Inventors: 
Miller, Joseph A.
Patent Number: 
US8685108
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2012-04-03
Grant Date: 
2014-04-01
Grant time: 
728 days
Grant time percentile rank: 
13
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Dynamic exoskeletal orthosis

Patent image
AMRMC

An exoskeletal orthosis includes a proximal cuff comprising a hinge along an upper edge of the cuff; an ankle section/footplate; and at least one posterior strut connecting the proximal cuff to the ankle section and foot plate.

Inventors: 
Blanck, Ryan Vaughn
Patent Number: 
US9186270
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2012-04-19
Grant Date: 
2015-11-17
Grant time: 
1,307 days
Grant time percentile rank: 
24
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Decision-assist method of resuscitation of patients

Patent image
AMRMC

A method for providing decision-assist to medical staff resuscitating a burn patient includes receiving patient information, calculating an infusion rate, outputting the infusion rate, obtaining a urinary output, calculating a new infusion rate using infusion rate model based constants, and outputting the new infusion rate. In some embodiments, the method includes notifying medical staff when problems arise, displaying information regarding the resuscitation, and setting limits regarding the infusion rates.

Inventors: 
Salinas, Jose; Kramer, George C.; Cancio, Leopoldo C.; Chung, Kevin; Mann, Elizabeth; Wolf, Steven E.; Drew, Guy A.
Patent Number: 
US8585675
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-01-29
Grant Date: 
2013-11-19
Grant time: 
1,025 days
Grant time percentile rank: 
18
Claim count percentile rank: 
6
Citations percentile rank: 
4
'Cited by' percentile rank: 
1
Assignee: 
UNIV TEXAS

Neurocognitive and psychomotor performance assessment and rehabilitation system

Patent image
AMRMC

A computerized Neuropsychological/NeuroCognitive and Psychomotor Performance Assessment and Rehabilitation system is designed for use on handheld computer systems. Components of the system include an executive program, test modules, interpretive and report modules, and supporting utilities. The system provides point-of-use interpretations and result reports. The system is designed for use in clinical settings, occupational medicine, and research. Medical applications include use as a diagnostic, evaluation, and treatment instrument. In industrial settings it can be used as a fitness/readiness for work assessment. The assessment and rehabilitation system also contains modules for use in forensic mental competency, mental and emotional status examinations.

Inventors: 
Elsmore, Timothy F.; Reeves, Dennis L.; Reeves, Legal Representative Marie Michelle; Winter, Kathryn P.; Friedl, Karl E.
Patent Number: 
US7837472
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2002-12-27
Grant Date: 
2010-11-23
Grant time: 
2,888 days
Grant time percentile rank: 
53
Claim count percentile rank: 
3
Citations percentile rank: 
2
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Critical care platform for litters

Patent image
AMRMC

The invention preferably includes a platform for attaching to patient carrying devices such as litters. The platform preferably is capable of attaching to accessory clips connected to medical instruments that are useful for carrying for a patient.

Inventors: 
Smeed, Eric M.
Patent Number: 
US6842922
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2002-12-17
Grant Date: 
2005-01-18
Grant time: 
763 days
Grant time percentile rank: 
13
Claim count percentile rank: 
9
Citations percentile rank: 
1
'Cited by' percentile rank: 
2
Assignee: 
US ARMY

Automated inhalation toxicology exposure system

Patent image
AMRMC

In one embodiment, a method includes but is not limited to exposing an animal to an inhalant; acquiring near real time measurement of at least respiration during said exposing; and calculating a received dose of the inhalant in response to the near real time measurement of the at least respiration during said exposing. In one embodiment, a method includes but is not limited to automatically controlling an environment of an inhalant chamber; and automatically controlling a concentration of an inhalant in the inhalant chamber. In one embodiment, a method includes but is not limited to displaying near real time measurement data related to an animal in an inhalant chamber. In addition to the foregoing, other method embodiments are described in the claims, drawings, and text forming a part of the present application. In one or more various embodiments, related systems include but are not limited to circuitry and/or programming for effecting the foregoing-described method embodiments; the circuitry and/or programming can be virtually any combination of hardware, software, and/or firmware configured to effect the foregoing-described method embodiments depending upon the design choices of the system designer. In one embodiment, a system includes but is not limited to at least one inhalant chamber; and at least one animal respiration sensor integral with the at least one inhalant chamber.

Inventors: 
Roy, Chad J.; Hartings, Justin M.
Patent Number: 
US6904912
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2001-07-31
Grant Date: 
2005-06-14
Grant time: 
1,414 days
Grant time percentile rank: 
26
Claim count percentile rank: 
21
Citations percentile rank: 
3
'Cited by' percentile rank: 
2
Assignee: 
US ARMY

Foley catheter adaptor

Patent image
AMRMC

A safety adaptor having attachment components and reservoir components for use with balloon anchored catheters such that if the catheter is forcibly removed the reservoir components will act as a safety valve and allow the anchoring balloon to deflate. The safety adaptor acts to minimize damage caused to a patient due to the removal of an inflated anchor balloon of a catheter. The safety adaptor attaches to any existing catheter having a fluid balloon and does not require re-engineering or re-tooling of the catheter or adaptor.

Inventors: 
Dabbs, Clifton R.
Patent Number: 
US7766870
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-04-20
Grant Date: 
2010-08-03
Grant time: 
1,566 days
Grant time percentile rank: 
28
Claim count percentile rank: 
5
Citations percentile rank: 
2
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Decision-assist method for resuscitation of patients

Patent image
AMRMC

A method for providing decision-assist to medical staff resuscitating a burn patient includes receiving patient information, calculating an infusion rate, outputting the infusion rate, obtaining a urinary output, calculating a new infusion rate using infusion rate model based constants, and outputting the new infusion rate. In some embodiments, the method includes notifying medical staff when problems arise, displaying information regarding the resuscitation, and setting limits regarding the infusion rates.

Inventors: 
Salinas, Jose; Kramer, George C.; Cancio, Leopoldo C.; Chung, Kevin; Mann, Elizabeth; Wolf, Steven E.; Drew, Guy A.
Patent Number: 
US7879020
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-03-19
Grant Date: 
2011-02-01
Grant time: 
1,049 days
Grant time percentile rank: 
19
Claim count percentile rank: 
6
Citations percentile rank: 
3
'Cited by' percentile rank: 
1
Assignee: 
UNIV TEXAS

Burn patient resuscitation system

Patent image
AMRMC

A method and system for operating a semi-closed loop and/or a closed loop resuscitation of a burn patient in view of patient information and other physiological data gathered as part of the method and/or by the system. The method in at least one embodiment includes receiving patient information, calculating an infusion rate based at least on part on a portion of the received patient information, outputting the infusion rate to an infusion pump, obtaining a urinary output, calculating a new infusion rate using infusion rate model based constants, and outputting the new infusion rate to an infusion pump. In some embodiments, the method includes notifying medical staff when problems arise, displaying information regarding the resuscitation, and setting limits regarding the infusion rates.

Inventors: 
Salinas, Jose; Kramer, George C.; Drew, Guy A.
Patent Number: 
US8157785
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2010-12-23
Grant Date: 
2012-04-17
Grant time: 
481 days
Grant time percentile rank: 
8
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNIV TEXAS

Convertible patient isolation pod

Patent image
AMRMC

A convertible isolation pod for an individual patient formed from sealable flexible plastic sheeting including an air intake grommet at the head end and an air exhaust grommet at the foot end of the pod each of the grommets being equipped with a valve to provide unidirectional air flow within the pod where the air is filtered to remove contaminants.

Inventors: 
Paschal Jr., Charles R.; Illi Jr., Orlando J.; Haubeil, George W.; Gauger, James R.; Mullins, Robert L.
Patent Number: 
US8245713
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2002-05-07
Grant Date: 
2012-08-21
Grant time: 
3,759 days
Grant time percentile rank: 
67
Claim count percentile rank: 
3
Citations percentile rank: 
2
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Medical tube securing device

Patent image
AMRMC

A medical tube securing device for a patient is disclosed, comprising at least one bite block and a support frame integral with said bite block, said support frame comprising a protruding extension with at least one inwardly recessed portion so as to avoid contact with the patient's mouth, said protruding extension operable to receive an adjustable medical tube retaining device without contacting the face of the patient.

Inventors: 
Beely, Brendan M.; Wright, Gabriel R.
Patent Number: 
US8302597
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2009-10-05
Grant Date: 
2012-11-06
Grant time: 
1,128 days
Grant time percentile rank: 
20
Claim count percentile rank: 
2
Citations percentile rank: 
2
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Burn patient resuscitation system

Patent image
AMRMC

A system for operating a semi-closed loop and/or a closed loop resuscitation of a burn patient in view of patient information and other physiological data gathered by the system. The system in at least one embodiment includes an urine sensor, an infusion pump and a processor that controls the operation of the infusion pump at least in part from a signal received from the urine sensor.

Inventors: 
Salinas, Jose; Kramer, George C.; Drew, Guy A.
Patent Number: 
US8597273
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2012-04-03
Grant Date: 
2013-12-03
Grant time: 
609 days
Grant time percentile rank: 
11
Claim count percentile rank: 
6
Citations percentile rank: 
4
'Cited by' percentile rank: 
1
Assignee: 
UNIV TEXAS

Collection and analysis of vital signs

Patent image
AMRMC

A system is disclosed having a storage, a communications module for interacting with a medical measurement device, an analysis controller, and a test module that allows for the testing and evaluating of decision-support algorithms. A method for testing decision-support algorithms is disclosed having the steps of receiving into storage of a ruggedized, compact computer at least one decision-support algorithm; detecting with a communications module the initiation of a vital-sign monitoring session; receiving and storing vital-sign information into storage by the communications module; pushing the stored vital-sign information by an analysis controller to a test module running the stored at least one decision-support algorithm; and providing at least one output from the decision-support algorithm to at least one of a database and a display.

Inventors: 
Reifman, Jaques; Khitrov, Maxim Y.; Reisner, Andrew T.; Chen, Liangyou; Mckenna, Thomas
Patent Number: 
US8694085
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-08-06
Grant Date: 
2014-04-08
Grant time: 
976 days
Grant time percentile rank: 
17
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Human monoclonal antibodies protective against bubonic plague

Patent image
AMRMC

In this application are described fully human monoclonal antibodies which specifically recognize F1 or V antigen of Y. pestis and epitopes recognized by these monoclonal antibodies. Also provided are mixtures of antibodies of the present invention, as well as methods of using individual antibodies or mixtures thereof for the detection, prevention, and/or therapeutical treatment of plague infections in vitro and in vivo.

Inventors: 
Amemiya, Kei; Dimitrov, Dimiter S.; Xiao, Xiaodong
Patent Number: 
US8722046
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2010-04-08
Grant Date: 
2014-05-13
Grant time: 
1,496 days
Grant time percentile rank: 
27
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Recombinantly expressed <i>Plasmodium </i>CelTOS antigen and methods of use thereof

Patent image
AMRMC

A synthetic nucleotide, which transcribes as the cell-traversal protein for ookinetes and sporozoites (CelTOS) antigen of Malaria Plasmodium, and methods of use thereof.

Inventors: 
Angov, Evelina; Bergmann-leitner, Elke; Ockenhouse, Christian
Patent Number: 
US9120868
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2009-11-23
Grant Date: 
2015-09-01
Grant time: 
2,108 days
Grant time percentile rank: 
38
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

DNA immunogenic composition comprising a full-length modified poxvirus L1R gene fused to a tPA leader sequence

Patent image
AMRMC

The invention described here encompasses DNA and protein vaccines against poxviruses, and relevant immunogenic compositions, comprising at a minimum a nucleic acid encoding a modified full-length poxvirus L1R gene or its ortholog. The L1R gene is modified so that an endoplasmic reticulum-targeting sequence is operably linked on the 5′ end. Preferably the nucleic acid sequences for other poxviruses antigens are also included, such as A33R, B5R and/or A27L. These vaccines and compositions provide improved neutralizing antibody response elicited by molecular poxvirus vaccines, over known vaccines using unmodified L1R.

Inventors: 
Hooper, Jay W.; Golden, Joseph W.
Patent Number: 
US8513005
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-07-07
Grant Date: 
2013-08-20
Grant time: 
1,870 days
Grant time percentile rank: 
34
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Compositions and methods for inhibiting expression of a gene from the Ebola virus

Patent image
AMRMC

The invention relates to a double-stranded ribonucleic acid (dsRNA) for inhibiting the expression of a gene from the Ebola virus.

Inventors: 
Bavari, Sina; Warfield, Kelly Lyn; Tan, Pamela; Borodovsky, Anna; Novobrantseva, Tatiana; De Fougerolles, Antonin
Patent Number: 
US9187516
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2014-05-15
Grant Date: 
2015-11-17
Grant time: 
551 days
Grant time percentile rank: 
10
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
ALNYLAM PHARMACEUTICALS INC

Antibodies with simultaneous subsite specificities to protein and lipid epitopes

Patent image
AMRMC

Antibodies and method of making antibodies, either monoclonal or polyclonal wherein said antibodies have dual or multi-specific binding capacity to more than one type of antigenic epitope. The antibodies have simultaneous or independent recognition subsites to each of the epitopes. Antigenic epitopes include lipids, peptides, proteins, amino acid sequences, sugars and carbohydrates. Monoclonal antibodies and a method of making monoclonal antibodies of the invention include monoclonal antibodies that are broadly neutralizing to HIV-1 or other envelop viruses wherein the monoclonal antibody has subsites that simultaneously recognize protein and lipid epitopes from the virus.

Inventors: 
Alving, Carl R.
Patent Number: 
US9119828
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-09-22
Grant Date: 
2015-09-01
Grant time: 
3,266 days
Grant time percentile rank: 
59
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Internal positive control for probe-based nucleic acid molecule assays and methods of making and using thereof

Patent image
AMRMC

Disclosed herein are isolated nucleic acid molecules that may be used as an internal positive controls in probe-based nucleic acid assays such as TaqMan® based assays. Also disclosed are probes comprising the isolated nucleic acid molecule of the present invention. The probes may comprise a reporter molecule and a quencher molecule. Also disclosed are assays which comprise using the probe of the present invention. The probes may be used to distinguish false negative results from true negative results in assays for a target nucleic acid molecule. The probe may be used in conjunction with probe-based nucleic acid assays for the detection of an organism such as one belonging to Bacillus, Mycobacterium, Francisella, Brucella, Clostridium, Yersinia, Variola, Orthopox, or Burkholderia.

Inventors: 
Hartman, Laurie J.; Norwood Jr., David A.
Patent Number: 
US7005267
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2003-03-03
Grant Date: 
2006-02-28
Grant time: 
1,093 days
Grant time percentile rank: 
20
Claim count percentile rank: 
7
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Monoclonal antibodies and complementarity-determining regions binding to Ebola glycoprotein

Patent image
AMRMC

In this application are described Ebola GP monoclonal antibodies, epitopes recognized by these monoclonal antibodies, and the sequences of the variable regions of some of these antibodies. Also provided are mixtures of antibodies of the present invention, as well as methods of using individual antibodies or mixtures thereof for the detection, prevention, and/or therapeutical treatment of Ebola virus infections in vitro and in vivo.

Inventors: 
Hart, Mary Kate; Wilson, Julie
Patent Number: 
US6875433
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2002-08-23
Grant Date: 
2005-04-05
Grant time: 
956 days
Grant time percentile rank: 
17
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
2
Assignee: 
US ARMY

Ricin vaccine and methods of making thereof

Patent image
AMRMC

Disclosed herein ricin toxin A chain polypeptides having an engineered disulfide bond ((SS)RTA) and compositions thereof. The disclosed (SS)RTA polypeptides retain the immunological epitope of wild type RTA, lack detectable N-glycosidase activity or exhibit reduced N-glycosidase activity as compared to controls, and exhibit increased solubility, thermal stability and a lower tendency to self-aggregate as compared to RTA 198 and/or RTA 1-33/44-198. Also disclosed are immunogenic compositions that may be used to immunize a subject against ricin intoxication. Methods of immunizing against, treating, inhibiting, reducing and/and preventing ricin intoxication are disclosed.

Inventors: 
Legler, Patricia M.; Compton, Jaimee R.; Millard, Charles B.; Olson, Mark A.
Patent Number: 
US9133253
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-04-21
Grant Date: 
2015-09-15
Grant time: 
1,608 days
Grant time percentile rank: 
29
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Bacterial superantigen vaccines

Patent image
AMRMC

The present invention relates to genetically attenuated superantigen toxin vaccines altered such that superantigen attributes are absent, however the superantigen is effectively recognized and an appropriate immune response is produced. The attenuated superantigen toxins are shown to protect animals against challenge with wild type toxin. Methods of producing and using the altered superantigen toxins are described.

Inventors: 
Ulrich, Robert G.; Olson, Mark A.; Bavari, Sina
Patent Number: 
US7378257
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2004-01-29
Grant Date: 
2008-05-27
Grant time: 
1,580 days
Grant time percentile rank: 
29
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
ARMY MEDICAL RES & MATERIEL COMMAND US

MVA expressing modified HIV envelope, gag, and pol genes

Patent image
AMRMC

The invention provides modified virus Ankara (MVA), a replication-deficient strain of vaccinia virus, expressing human immunodeficiency virus (HIV) env, gag, and pol genes.

Inventors: 
Moss, Bernard; Earl, Patricia L.; Wyatt, Linda; Eller, Leigh Anne; Vancott, Thomas C.; Harris, Matthew Edward
Patent Number: 
US7303754
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2005-09-28
Grant Date: 
2007-12-04
Grant time: 
797 days
Grant time percentile rank: 
14
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Monoclonal antibodies to Ebola glycoprotein

Patent image
AMRMC

In this application are described Ebola GP monoclonal antibodies and epitopes recognized by these monoclonal antibodies. Also provided are mixtures of antibodies of the present invention, as well as methods of using individual antibodies or mixtures thereof for the detection, prevention, and/or therapeutical treatment of Ebola virus infections in vitro and in vivo.

Inventors: 
Hart, Mary K.; Wilson, Julie A.; Schmaljohn, Alan L.
Patent Number: 
US6630144
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2000-08-29
Grant Date: 
2003-10-07
Grant time: 
1,134 days
Grant time percentile rank: 
20
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Anti-microbial peptidomimetic compounds and methods to calculate anti-microbial activity

Patent image
AMRMC

This invention encompasses synthetic antimicrobial peptide analogs having certain un-natural amino acids, including the un-natural amino acids hydrophobic tetrahydroisoquinolinecarboxylic acid (Tic) and octahydroindolecarboxylic acid (Oic), incorporated into the polypeptide backbone. These antimicrobial peptides (AMPs) are useful to treat infection in humans and other mammals of such bacteria as Gram positive bacteria, Gram negative bacteria and Mycobacterium. Many of the AMPs also exhibit the property of reduced hemolytic activity. The invention also entails 3D-QSAR models and mathematical equations that calculate the biological activity of any peptide sequence against Staphylococcus aureus or Mycobacterium ranae.

Inventors: 
Hicks, Rickey P.; Venugopal, Diva Karamenon; Bhonsle, Jayendra
Patent Number: 
US8188033
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2007-12-20
Grant Date: 
2012-05-29
Grant time: 
1,622 days
Grant time percentile rank: 
29
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Peptides responsive to antibodies against consensus peptide of the CS4-CFA/I family proteins

Patent image
AMRMC

This invention relates to amino acid sequences from within a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA(SEQ ID. NO: 1) Eight mer peptides from within the consensus peptide were tested against an antibody raised to the consensus peptide. Studies relating to antibody raised to denatured proteins from the natural organisms producing the family of proteins were also useful and showed particular value of some sequences. A sequence of the formula ASVDPTIDLLQA (SEQ ID NO: 2) was identified thereby. An enlarge sequence of the formula TVTASVDPTIDLLQAD (SEQ ID NO: 3) is also especially interesting as are intermediate sequences such as sequences VTASVDPTIDLLQAD (SEQ ID NO: 4), TASVDPTIDLLQAD (SEQ ID NO: 5), and TASVDPTIDLLQA (SEQ ID NO: 6) as being binding sites for antibodies raised to the denatured proteins.

Inventors: 
Cassels, Frederick J.; Loomis-price, Lawrence
Patent Number: 
US7404961
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2004-01-12
Grant Date: 
2008-07-29
Grant time: 
1,660 days
Grant time percentile rank: 
30
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Anaerobic microbial composition and methods of using same

Patent image
AMRMC

A microbial composition for concurrent dechlorination of a mixture of chlorinated ethanes and chlorinated ethenes includes a isolated consortium of bioremediative microorganisms comprising strains of microorganism comprising Clostridium, Acetobacterium, Dehalobacter, Bacteroides, and Proteobacteria. The composition may also include Methanomicrobia.

Inventors: 
Lorah, Michelle M.; Jones, Elizabeth J.; Voytek, Mary A.
Patent Number: 
US8673614
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-11-18
Grant Date: 
2014-03-18
Grant time: 
851 days
Grant time percentile rank: 
15
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US INTERIOR

Monoclonal antibody which agglutinates <i>E. coli </i>having the CS4-CFA/I family protein

Patent image
AMRMC

A monoclonal antibody to a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA.(SEQ ID NO:1) The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS (SEQ ID NO:2) and has use as a diagnostic and for prophylaxis against illness arising from E. coli which produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom.

Inventors: 
Cassels, Frederick J.; Lees, Andrew; Schuman, Richard F.
Patent Number: 
US7566540
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2004-06-10
Grant Date: 
2009-07-28
Grant time: 
1,874 days
Grant time percentile rank: 
34
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Plasmodium liver stage antigens

Patent image
AMRMC

The invention provides isolated liver stage Plasmodium polypeptides comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-48 and immunogenic derivatives thereof. The invention also provides isolated nucleic acid molecules encoding the liver stage Plasmodium polypeptides of the invention, compositions comprising one or more liver stage Plasmodium polypeptides of the invention, methods for inducing an immune response against the liver stage Plasmodium polypeptides, and methods for treating and diagnosing liver stage malaria.

Inventors: 
Duffy, Patrick; Krzych, Urszula; Heppner Jr., Donald G.; Malkov, Vladislav A.; Wendler, Jason W.; Bacik, Igor
Patent Number: 
US7722889
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-09-29
Grant Date: 
2010-05-25
Grant time: 
1,334 days
Grant time percentile rank: 
24
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNIV DREXEL

Screening methods using normal human liver cell line

Patent image
AMRMC

In this application is described the establishment and maintenance of a normal human hepatocyte cell line able to support complete development of malaria parasite development in vitro. The cell line can be used in methods for screening compounds affecting normal human liver cells or normal human cells infected with malaria parasites, measuring uptake of drugs or chemicals into normal human liver cells, and measuring metabolism of a drug in a normal human liver cell. Other advantages and uses of the cell line are also described.

Inventors: 
Prachumsri, Jetsumon; Yimamnuaychok, Nongnuch
Patent Number: 
US7781186
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-01-19
Grant Date: 
2010-08-24
Grant time: 
1,678 days
Grant time percentile rank: 
30
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

<i>Plasmodium </i>liver stage antigens

Patent image
AMRMC

The invention provides isolated liver stage Plasmodium polypeptides comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:1-48 and immunogenic derivatives thereof. The invention also provides isolated nucleic acid molecules encoding the liver stage Plasmodium polypeptides of the invention, compositions comprising one or more liver stage Plasmodium polypeptides of the invention, methods for inducing an immune response against the liver stage Plasmodium polypeptides, and methods for treating and diagnosing liver stage malaria.

Inventors: 
Duffy, Patrick; Kappe I, Stefan H.; Krzych, Urszula; Heppner, Donald G.; Bergman, Lawrence W.; Malkov, Vladislav A.; Tarun, Alice; Wendler, Jason P.; Bacik, Igor
Patent Number: 
US8318183
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2010-03-11
Grant Date: 
2012-11-27
Grant time: 
992 days
Grant time percentile rank: 
18
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
SEATTLE BIOMEDICAL RES INST; US ARMY; PHILADELPHIA HEALTH & EDUCATION CORP

Recombinant F1-V plague vaccine

Patent image
AMRMC

Disclosed herein is a composition comprising a purified fusion protein comprising all or part of F1 antigen of Yersinia pestis fused to the amino terminus of all of V antigen of Yersinia pestis, Yersinia enterocolitica, or Yersinia pseudotuberculosis that is isolated from its expression vector.

Inventors: 
Heath, David G.; Friedlander, Arthur M.; Anderson Jr., George W.; Welkos, Susan L.
Patent Number: 
US8647633
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-05-06
Grant Date: 
2014-02-11
Grant time: 
2,107 days
Grant time percentile rank: 
38
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Treatment methods using an F1-V plague vaccine

Patent image
AMRMC

Disclosed herein is a method of inducing an immunological response in a subject which comprises administering an immunogenic amount of a purified fusion protein comprising all or part of F1 antigen of Yersinia pestis fused to the amino terminus of all of V antigen of Yersinia pestis, Yersinia enterocolitica, or Yersinia pseudotuberculosis to the subject.

Inventors: 
Heath, David G.; Friedlander, Arthur M.; Anderson Jr., George W.; Welkos, Susan L.
Patent Number: 
US8795677
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-05-06
Grant Date: 
2014-08-05
Grant time: 
2,282 days
Grant time percentile rank: 
42
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Antibodies against type A botulinum neurotoxin

Patent image
AMRMC

Antibodies for binding epitopes of BoNT/A and hybridomas which produce such antibodies are described. The antibodies of the present invention can be used in a method for detecting BoNT/A in a sample and/or in a method for purifying BoNT/A from an impure solution. In addition, the antibodies can be used for passive immunization against BoNT/A intoxication or as intoxication therapy. Another aspect of the invention is a kit for detecting BoNT/A in a sample.

Inventors: 
Bavari, Sina; Torres Melendez, Edna R.; Lebeda, Frank J.
Patent Number: 
US7879330
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-03-06
Grant Date: 
2011-02-01
Grant time: 
1,793 days
Grant time percentile rank: 
33
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Burn patient resuscitation system

Patent image
AMRMC

A system for operating a semi-closed loop and/or a closed loop resuscitation of a burn patient in view of patient information and other physiological data gathered by the system. The system in at least one embodiment includes an urine sensor, an infusion pump and a processor that controls the operation of the infusion pump at least in part from a signal received from the urine sensor.

Inventors: 
Salinas, Jose; Kramer, George C.; Drew, Guy A.
Patent Number: 
US9272090
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2013-12-02
Grant Date: 
2016-03-01
Grant time: 
820 days
Grant time percentile rank: 
15
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY; UNIV TEXAS

Ricin toxin A-chain fragment for use as a vaccine

Patent image
AMRMC

Disclosed herein are polypeptides and variants thereof comprising a polypeptide sequence having substantial identity to ricin A chain (RTA) that lack detectable N-glycosidase-rRNA activity or exhibit reduced N-glycosidase-rRNA activity as compared to controls and methods of making and using thereof. The polypeptides and variants have a greater solubility in aqueous solutions of physiological pH and ionic strength than RTA and also retain the integrity of the neutralizing immunological epitope of wild type RTA. Also disclosed are immunogenic compositions that may be used to immunize a subject against ricin intoxication. Methods of immunizing against, treating, and preventing ricin intoxication are disclosed.

Inventors: 
Olson, Mark A.; Millard, Charles B.; Byrne, Michael P.; Wannemacher, Robert W.
Patent Number: 
US7407935
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2004-08-23
Grant Date: 
2008-08-05
Grant time: 
1,443 days
Grant time percentile rank: 
26
Claim count percentile rank: 
2
Citations percentile rank: 
2
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Compositions and methods for inhibiting expression of a gene from the ebola virus

Patent image
AMRMC

The invention relates to a double-stranded ribonucleic acid (dsRNA) for inhibiting the expression of a gene from the Ebola virus.

Inventors: 
Bavari, Sina; Warfield, Kelly Lyn; Tan, Pamela; Borodovsky, Anna; Novobrantseva, Tatiana; De Fougerolles, Antonin
Patent Number: 
US7973020
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2010-05-27
Grant Date: 
2011-07-05
Grant time: 
404 days
Grant time percentile rank: 
7
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
ALNYLAM PHARMACEUTICALS INC

Monoclonal antibodies and complementarity-determining regions binding to Ebola glycoprotein

Patent image
AMRMC

In this application are described Ebola GP monoclonal antibodies, epitopes recognized by these monoclonal antibodies, and the sequences of the variable regions of some of these antibodies. Also provided are mixtures of antibodies of the present invention, as well as methods of using individual antibodies or mixtures thereof for the detection, prevention, and/or therapeutical treatment of Ebola virus infections in vitro and in vivo.

Inventors: 
Hart, Mary Kate; Wilson, Julie
Patent Number: 
US7335356
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2004-12-16
Grant Date: 
2008-02-26
Grant time: 
1,167 days
Grant time percentile rank: 
21
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Plasmodium falciparum AMA-1 protein and uses thereof

Patent image
AMRMC

In this application is described the expression and purification of a recombinant Plasmodium falciparum (3D7) AMA-1 ectodomain. The method of the present invention produces a highly purified protein which retains folding and disulfide bridging of the native molecule. The recombinant AMA-1 is useful as a diagnostic reagent, for use in antibody production, and as a protein for use alone, or as part of, a vaccine to prevent malaria.

Inventors: 
Lanar, David E.; Dutta, Sheetij; Ware, Lisa A.; Nair V, Lalitha P.
Patent Number: 
US7029685
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2002-10-15
Grant Date: 
2006-04-18
Grant time: 
1,281 days
Grant time percentile rank: 
23
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
2
Assignee: 
US ARMY

Unique calibrator polynucleotides and methods of using in quantitative nucleic acid assays

Patent image
AMRMC

Disclosed herein are polynucleotides which may be used to calibrate or standardize quantitative nucleic acid assays. As disclosed, the polynucleotides comprise a sequence derived from a plant viroid polynucleotide or a bacterial or chloroplast Type II intron polynucleotide. Also disclosed are methods of making and using the polynucleotides.

Inventors: 
Phillips, Christopher S.; Ruff, Albert L.; Dillman III, James F.
Patent Number: 
US8642746
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-07-10
Grant Date: 
2014-02-04
Grant time: 
2,035 days
Grant time percentile rank: 
37
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Antibodies against type a botulinum neurotoxin

Patent image
AMRMC

Antibodies for binding epitopes of BoNT/A and hybridomas which produce such antibodies are described. The antibodies of the present invention can be used in a method for detecting BoNT/A in a sample and/or in a method for purifying BoNT/A from an impure solution. In addition, the antibodies can be used for passive immunization against BoNT/A intoxication or as intoxication therapy. Another aspect of the invention is a kit for detecting BoNT/A in a sample.

Inventors: 
Bavari, Sina; Torres Melendez, Edna R.; Lebeda, Frank J.
Patent Number: 
US7049085
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2003-09-04
Grant Date: 
2006-05-23
Grant time: 
992 days
Grant time percentile rank: 
18
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Alertness/drowsiness and cognitive capacity index

Patent image
AMRMC

The invention includes a method and system for providing an Index representing the alertness state of an individual based at least in part on EEG signals obtained from the individual. In at least one embodiment, the EEG signals are divided into frequency bands and a total amplitude of the power is determined. Based on the proportion of the high frequency band compared to the proportion of the low frequency band, an Index is determined that is indicative of an individual's ability to perform a cognitive task.

Inventors: 
Sing, Helen C.
Patent Number: 
US8285372
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-12-19
Grant Date: 
2012-10-09
Grant time: 
1,390 days
Grant time percentile rank: 
25
Claim count percentile rank: 
8
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Device and method for inducing brain injury in animal test subjects

Patent image
AMRMC

An apparatus and method for inflicting brain injury on a laboratory animal that employs a platform for supporting the laboratory animal. The platform defines an opening for positioning the head of the laboratory animal over the opening. A projectile is launched from a projectile launching device orientated below the opening of the platform. The projectile launching device has a means for propelling the projectile directly at and/or through the opening of said platform, thereby inflicting brain injury on the animal via either a pressure wave or concussive impact of the projectile. Without helmet, direct impact of the projectile results in severe traumatic brain injury. Use of helmet protects animals from skull fracture, subdural hematoma, intracerebral hemorrhage and contusion yet produces mild concussion-like pathology.

Inventors: 
Chen, Zhiyong; Liao, Zhilin; Tortella, Frank C.; Lu, Xi-chun May; Dave, Jitendra R.; Bartlett, Jay E.; Arnold, Mark F.; Easterday, Mark P.; Brown, Mark W.; Holmes, Larry R.; Larimore, Zachary J.; Schmid, Kara E.; Shear, Deborah A.; Leung, Lai Yee; Mountney, Andrea
Patent Number: 
US8973565
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2012-08-08
Grant Date: 
2015-03-10
Grant time: 
944 days
Grant time percentile rank: 
17
Claim count percentile rank: 
13
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

CR-2 binding peptide P28 as molecular adjuvant for DNA vaccines

Patent image
AMRMC

The invention is an DNA vaccine and method of use thereof for modulating the immune response against the circumsporozoite protein (CSP) of malaria parasites, using the CR2 binding motifs of C3d, especially p28.

Inventors: 
Bergmann-leitner, Elke S.; Angov, Evelina; Tsokos, George C.
Patent Number: 
US8470560
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-10-03
Grant Date: 
2013-06-25
Grant time: 
1,726 days
Grant time percentile rank: 
31
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
4
Assignee: 
US ARMY

<i>Plasmodium vivax </i>hybrid circumsporozoite protein and vaccine

Patent image
AMRMC

Described in this application is a synthetic P. vivax circumsporozoite protein useful as a diagnostic reagent, for antibody production, and as a vaccine protective against infection with any strain of P. vivax.

Inventors: 
Yadava, Anjali; Ockenhouse, Christian F.
Patent Number: 
US8258280
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2010-07-09
Grant Date: 
2012-09-04
Grant time: 
788 days
Grant time percentile rank: 
14
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Construction of West Nile virus and dengue virus chimeras for use in a live virus vaccine to prevent disease caused by West Nile virus

Patent image
AMRMC

The present invention relates to attenuated, immunogenic West Nile virus chimeras built on a dengue virus backbone for the production of immunogenic, live, attenuated West Nile virus vaccines.

Inventors: 
Pletnev, Alexander G.; Putnak, Joseph R.; Chanock, Robert M.; Murphy, Brian R.; Whitehead, Stephen S.; Blaney Jr., Joseph E.
Patent Number: 
US8778671
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2004-06-18
Grant Date: 
2014-07-15
Grant time: 
3,679 days
Grant time percentile rank: 
66
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Cleavage sensitive antibodies and methods of use thereof

Patent image
AMRMC

We disclose cleavage-sensitive antibodies with epitopes spanning the scissile bond of the toxins molecular target protein, enabling toxin-associated proteolysis to be measured in a variety of assay formats.

Inventors: 
Bavari, Sina; Nuss, Jonathan E.
Patent Number: 
US8936915
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2010-08-17
Grant Date: 
2015-01-20
Grant time: 
1,617 days
Grant time percentile rank: 
29
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Compositions and methods for inhibiting expression of a gene from the ebola virus

Patent image
AMRMC

The invention relates to a double-stranded ribonucleic acid (dsRNA) for inhibiting the expression of a gene from the Ebola virus.

Inventors: 
Bavari, Sina; Warfield, Kelly Lyn; Tan, Pamela; Borodovsky, Anna; Novobrantseva, Tatiana; De Fougerolles, Antonin
Patent Number: 
US8354390
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-04-25
Grant Date: 
2013-01-15
Grant time: 
631 days
Grant time percentile rank: 
11
Claim count percentile rank: 
5
Citations percentile rank: 
2
'Cited by' percentile rank: 
1
Assignee: 
ALNYLAM PHARMACEUTICALS INC

Plasmodium falciparum AMA-1 protein and uses thereof

Patent image
AMRMC

In this application is described the expression and purification of a recombinant Plasmodium falciparum (3D7) AMA-1 ectodomain. The method of the present invention produces a highly purified protein which retains folding and disulfide bridging of the native molecule. The recombinant AMA-1 is useful as a diagnostic reagent, for use in antibody production, and as a vaccine.

Inventors: 
Lanar, David E.; Dutta, Sheetij; Ware, Lisa A.; Nair V, Lalitha P.
Patent Number: 
US7060276
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2002-03-25
Grant Date: 
2006-06-13
Grant time: 
1,541 days
Grant time percentile rank: 
28
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
2
Assignee: 
US ARMY

Construction of live attenuated <i>Shigella </i>vaccine strains that express CFA/I antigens (CfaB and CfaE) and the B subunit of heat-labile enterotoxin (LTB) from enterotoxigenic <i>E. coli</i>

Patent image
AMRMC

With the goal of creating a combination vaccine against Shigella and other diarrheal pathogens we have constructed a prototype vaccine strain of Shigella flexneri 2a (SC608) that can serve as a vector for the expression and delivery of heterologous antigens to the mucosal immune system. SC608 is an asd derivative of SC602, a well-characterized vaccine strain, which has recently undergone several phase 1 and 2 trials for safety and immunogenicity. Using non-antibiotic asd-based plasmids, we have created novel constructs for the expression of antigens from enterotoxigenic E. coli (ETEC), including CFA/I (CfaB and CfaE) and the B-subunit from heat-labile enterotoxin (LTB) in Shigella vaccine strain SC608. Heterologous protein expression levels and cellular localization are critical to immune recognition and have been verified by immunoblot analysis. Following intranasal immunization (SC608(CFAI) and SC608(CFAI/LTB) of guinea pigs, serum IgG and IgA immune responses to both the Shigella LPS and ETEC antigens can be detected by ELISA. In addition, ELISPOT analysis for ASCs from cervical lymph nodes and spleen showed similar responses. All vaccine strains conferred high levels of protection against challenge with wild-type S. flexneri 2a using the Sereny test. Furthermore, serum from guinea pigs immunized with SC608 expressing CfaB and LTB contained antibodies capable of neutralizing the cytological affects of heat-labile toxin (HLT) on Chinese Hamster Ovary (CHO) cells. These initial experiments demonstrate the validity of a multivalent invasive Shigella strain that can serve as a vector for the delivery of pathogen-derived antigens.

Inventors: 
Ranallo, Ryan T.; Venkatesan, Malabi M.
Patent Number: 
US7759106
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2005-05-19
Grant Date: 
2010-07-20
Grant time: 
1,888 days
Grant time percentile rank: 
34
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Ricin vaccine and methods of making and using thereof

Patent image
AMRMC

Disclosed herein are polypeptides and variants thereof comprising a polypeptide sequence having substantial identity to ricin A chain (RTA) that lack detectable N-glycosidase-rRNA activity or exhibit reduced N-glycosidase-rRNA activity as compared to controls and methods of making and using thereof. The polypeptides and variants have a greater solubility in aqueous solutions of physiological pH and ionic strength than RTA and also retain the integrity of the neutralizing immunological epitope of wild type RTA. Also disclosed are immunogenic compositions that may be used to immunize a subject against ricin intoxication. Methods of immunizing against, treating, and preventing ricin intoxication are disclosed.

Inventors: 
Olson, Mark A.; Millard, Charles B.; Byrne, Michael P.; Wannemacher, Robert W.; Leclaire, Ross D.
Patent Number: 
US6869787
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2002-02-27
Grant Date: 
2005-03-22
Grant time: 
1,119 days
Grant time percentile rank: 
20
Claim count percentile rank: 
7
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Internal positive control for probe-based nucleic acid molecule assays and methods of making and using thereof

Patent image
AMRMC

Disclosed herein are isolated nucleic acid molecules that may be used as an internal positive controls in probe-based nucleic acid assays such as TaqMan® based assays. Also disclosed are probes comprising the isolated nucleic acid molecule of the present invention. The probes may comprise a reporter molecule and a quencher molecule. Also disclosed are assays which comprise using the probe of the present invention. The probes may be used to distinguish false negative results from true negative results in assays for a target nucleic acid molecule. The probe may be used in conjunction with probe-based nucleic acid assays for the detection of an organism such as one belonging to Bacillus, Mycobacterium, Francisella, Brucella, Clostridium, Yersinia, Variola, Orthopox, or Burkholderia.

Inventors: 
Hartman, Laurie J.; Norwood Jr., David A.; Wasieloski Jr., Leonard P.
Patent Number: 
US7052848
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2004-12-22
Grant Date: 
2006-05-30
Grant time: 
524 days
Grant time percentile rank: 
9
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Artificial invaplex

Patent image
AMRMC

An artificial invasin complex is prepared from purified or recombinantly prepared invasins and gram negative bacteria lipopolysaccharides. Typically, IpaB is mixed with IpaC to form a IpaB:IpaC complex. This invasin protein complex is then mixed with the lipopolysaccharide to form an artificial invasin complex. Additional bioactive molecules can be incorporated into the complex during manufacture. This artificial invasin complex is similar in function to native Invaplex 24 or Invaplex 50. The artificial invasin complex has superior immunogenicity properties relative to the native complex and can be tailor made. Its method of preparation lends itself to scale up. The artificial invasin complex can facilitate transport of biomolecules, therapeutics and antibiotics across cell membranes in a manner similar to native Shigella Invaplex.

Inventors: 
Oaks, Edwin V.; Turbyfill, Kevin R.; Kaminski, Robert W.
Patent Number: 
US7780966
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2007-03-27
Grant Date: 
2010-08-24
Grant time: 
1,246 days
Grant time percentile rank: 
22
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

System and method for providing servo-controlled resuscitation

Patent image
AMRMC

The present invention provides a system and method for controlling resuscitation in a patient. In at least one embodiment, the invention includes a fluid rate measurer, a controller electrically coupled to the fluid rate measurer, and a pump. The controller is adapted to receive signals from a physiological monitor and controls the pump.

Inventors: 
Sondeen, Jill L.; Drew, Guy A.
Patent Number: 
US8663156
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2012-09-14
Grant Date: 
2014-03-04
Grant time: 
536 days
Grant time percentile rank: 
9
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

<i>Plasmodium vivax </i>hybrid circumsporozoite protein and vaccine

Patent image
AMRMC

Described in this application is a synthetic P. vivax circumsporozoite protein useful as a diagnostic reagent, for antibody production, and as a vaccine protective against infection with any strain of P. vivax.

Inventors: 
Yadava, Anjali; Ockenhouse, Christian F.
Patent Number: 
US8697856
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2012-08-03
Grant Date: 
2014-04-15
Grant time: 
620 days
Grant time percentile rank: 
11
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Decision-assist method of resuscitation of patients

Patent image
AMRMC

A method for providing decision-assist to medical staff resuscitating a burn patient includes receiving patient information, calculating an infusion rate, outputting the infusion rate, obtaining a urinary output, calculating a new infusion rate using infusion rate model based constants, and outputting the new infusion rate. In some embodiments, the method includes notifying medical staff when problems arise, displaying information regarding the resuscitation, and setting limits regarding the infusion rates.

Inventors: 
Salinas, Jose; Kramer, George C.; Cancio, Leopoldo C.; Chung, Kevin; Mann, Elizabeth; Wolf, Steven E.; Guy, Drew A.
Patent Number: 
US9061101
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2013-11-18
Grant Date: 
2015-06-23
Grant time: 
582 days
Grant time percentile rank: 
10
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY; UNIV TEXAS

Modular prosthetic foot

Patent image
AMRMC

A modular prosthetic foot characterized by an ankle component; a forefoot component having a circular part with a rounded top surface and at least one flat side surface, said circular part being connected to a rear part of the forefoot component; a forefoot cushion bumper positioned around the circular part; and a heel component.

Inventors: 
Miller, Joseph A.
Patent Number: 
US8172909
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-12-21
Grant Date: 
2012-05-08
Grant time: 
1,965 days
Grant time percentile rank: 
36
Claim count percentile rank: 
6
Citations percentile rank: 
2
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Aerosol particle analyzer for measuring an analyte in airborne particles

Patent image
ARL

Aerosol particle analyzer (APA) for measuring an analyte in airborne particle is described. Airborne particles are first given an electrical charge and then drawn in air past an oppositely charged volume of an analysis liquid that exposed to the air at a small hole in a container, such as a capillary, that holds that analysis liquid. Electrostatic forces enhance the rate that the airborne particles collide with the small exposed volume of the analysis liquid in the hole. If the particles that collide with the analysis liquid contain the analyte, an optical property of the analysis liquid, such as the fluorescence, varies according to the amount of the analyte in the particles. This optical property is measured and the amount of analyte in the particles is determined from the measured optical property.

Inventors: 
Lin, Horn-bond; Hill, Steven Clyde
Patent Number: 
US7201878
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2004-03-26
Grant Date: 
2007-04-10
Grant time: 
1,110 days
Grant time percentile rank: 
20
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Microelectromechanical resonant photoacoustic cell

Patent image
ARL

An integrated photoacoustic spectroscopy (PAS) cell is fabricated using microelectromechanical (MEMS) techniques. The multi-layer structure includes an inner layer with a patterned resonant cavity disposed between top and bottom outer layers and a microphone acoustically coupled to the resonant cavity. In the preferred embodiment, the microphone is a piezoelectric thin-film membrane formed on one of the outer layers. The inner layer is additionally patterned to include buffer cavities on either side of the resonant cavity, and one or both of the top and bottom outer layers are also patterned to include buffer cavities aligned with the buffer cavities in the inner layer on either side of the resonant cavity. The preferred fabrication method involves joining an inner silicon substrate to a pair of outer silicon substrates, thereby encapsulating the resonant cavity, and depositing a piezoelectric thin film onto one of the outer substrates which is then patterned to create an acoustic sensor.

Inventors: 
Polcawich, Ronald G.; Pellegrino, Paul
Patent Number: 
US7304732
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2003-11-19
Grant Date: 
2007-12-04
Grant time: 
1,476 days
Grant time percentile rank: 
27
Claim count percentile rank: 
1
Citations percentile rank: 
2
'Cited by' percentile rank: 
2
Assignee: 
US ARMY

Systems and methods for collecting particles from a large volume of gas into a small volume of liquid

Patent image
ARL

Systems and methods for collecting particles are provided. A representative system includes an aerosol-into-liquid collector that stores a collection liquid. The aerosol-into-liquid collector also includes a container, a gas inlet, a gas outlet and a source of vacuum pressure such that, when the source of vacuum pressure provides vacuum pressure at the gas outlet, gas with particles entrained therein is drawn into the container through the gas inlet. A well holds a volume of the collection liquid such that at least some of the particles entrained in the gas collide with the collection liquid and adhere thereto. Gas drawn into the container impinges upon an exposed surface of the collection liquid in the well. Forces exerted by the gas do not tend to push the collection liquid out of the well or cause the collection liquid to break into multiple droplets.

Inventors: 
Hill, Steven C.
Patent Number: 
US7631567
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-08-18
Grant Date: 
2009-12-15
Grant time: 
1,215 days
Grant time percentile rank: 
22
Claim count percentile rank: 
3
Citations percentile rank: 
2
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Blast, ballistic and blunt trauma sensor

Patent image
ARL

A molecular biosensor is provided including a lipid vesicle and a housing wherein the vesicle is contained on or within the housing and where the housing has a portion capable of transmitting a force generated, external to the housing to the vesicle. The biosensor is used in processes of detecting the presence or absence of an event force such as a blast or blunt force sufficient to produce a medical complication such as traumatic brain injury.

Inventors: 
Mentzer, Mark Andrew
Patent Number: 
US9080984
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2013-01-10
Grant Date: 
2015-07-14
Grant time: 
915 days
Grant time percentile rank: 
16
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Systems and methods for individually trapping particles from air and measuring the optical spectra or other properties of individual trapped particles

Patent image
ARL

Embodiments of the present invention are directed to systems and methods for continuously sampling particles from air. In one embodiment, a system for continuously sampling particles from air may include: an airflow system configured to continuously draw air including airborne particles into the system; a photophoretic trap that uses photophoretic forces of a laser beam to trap one or more of the airborne particles from the drawn air; a measurement device configured to measure one or more properties of the trapped one or more airborne particles; and a controller configured to repeatedly trap, measure and release one or more airborne particles.

Inventors: 
Hill, Steven C.; Pan, Yongle
Patent Number: 
US9222874
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2013-03-11
Grant Date: 
2015-12-29
Grant time: 
1,023 days
Grant time percentile rank: 
18
Claim count percentile rank: 
7
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
UNITED STATES OF AMERICA AS REPRESENTED BY THE THE

Systems and methods for adaptive mitigation of motion sickness

Patent image
ARL

Methods and apparatus for adaptively mitigating motion sickness in an operator are provided herein. In some embodiments, a compensatory modulator for use with a display controller included in a system to adaptively mitigating motion sickness in an operator may include one or more inputs to receive at least one of physiological measurements of the operator or operator activity behavior from one or more monitoring devices, and a motion sickness expert system configured to (a) determine a cognitive state of the operator based on the received inputs, (b) compute mitigating display parameters based on the determined cognitive state of the operator, (c) output the computed mitigating display parameters to the display controller.

Inventors: 
Smyth, Christopher C.
Patent Number: 
US8708884
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2013-03-11
Grant Date: 
2014-04-29
Grant time: 
414 days
Grant time percentile rank: 
7
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Method and apparatus for estimating cerebral cortical source activations from electroencephalograms

Patent image
ARL

Methods and apparatuses for estimating activation of cerebral cortical sources from scalp site measurements of electroencephalograms (EEG) from a human subject are provided. In an exemplary embodiment, a method comprises: specifying cortical neural sources within the brain of the subject; simulating activation potentials for the specified cortical neural sources; projecting the simulated cortical neural source voltage activations to scalp site measurements locations for the subject; simulating scalp voltage potentials for one or more extra-cranial sources outside the brain; constructing simulated scalp site voltage potentials from the projected simulated modeled cortical neural source voltage activations and the simulated extra-cranial scalp voltage potentials; comparing the simulated scalp site voltage potentials and the electroencephalograms scalp site measurements for the subject; and adjusting parameters for simulating the cortical neural source voltage activations until the simulated scalp site voltage potentials generally correspond to the electroencephalograms scalp site measurements based on the comparison.

Inventors: 
Smyth, Christopher C.
Patent Number: 
US9116835
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2014-09-29
Grant Date: 
2015-08-25
Grant time: 
330 days
Grant time percentile rank: 
5
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Distributive transmissometer

Patent image
NAWCAD

A distributive transmissometer, comprising a series of light sources that illuminate and map out a volume of space to be sampled to a one-dimensional space, a light detector, the one-dimensional space being mapped to the light detector such that spatial dust density distribution of the volume to be sampled can be determined; and, a lens for focusing light emitted by the light sources toward the light detector.

Inventors: 
Sugrim, Chandraika; Berry, Rollie Dewayne; Ferguson, Gerald
Patent Number: 
US9164035
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2014-02-18
Grant Date: 
2015-10-20
Grant time: 
609 days
Grant time percentile rank: 
11
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Hybrid lidar-radar for medical diagnostics

Patent image
NAWCAD

A hybrid lidar-radar system for detecting the presence of objects, such as cancerous tumors, within tissues by detecting reflected signals from the tissue and discriminating the information related to the cancerous tumor from the undesirable backscattering of light created by the tissue itself. The hybrid lidar-radar system utilizes continuous wave light that is preferably modulated at frequencies up to 60 GHz. The present invention filters the return signals from the tissue at a subcarrier modulation frequency so as to reject erroneous information contained in scattered lights, while at the same time retaining the coherent, unscattered and modulated light information so as to provide for an accuracy detection of tumors within tissues.

Inventors: 
Mullen, Linda J.; Contarino, Vincent M.; Herczfeld, Peter R.
Patent Number: 
US7010339
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2002-07-29
Grant Date: 
2006-03-07
Grant time: 
1,317 days
Grant time percentile rank: 
24
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Interim dental dressing and restorative material

Patent image
NMRC

The invention relates to a temporary dental formulation useful as a durable, temporary restorative. The formulation changes color during mixing to assist the operator in ensuring adequacy of mixing and enhancing visualization during placement.

Inventors: 
Tiba, Amer; Charlton, David G.; Ragain, James C.
Patent Number: 
US7649028
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2007-01-24
Grant Date: 
2010-01-19
Grant time: 
1,091 days
Grant time percentile rank: 
20
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Recombinant antigen for diagnosis and prevention of murine typhus

Patent image
NMRC

The invention relates to a recombinant immunogenic composition from Rickettsia typhi. The invention also relates to a method for the use of the recombinant proteins in detection and diagnostic assays and as a component in formulations for the induction of an anti-R. typhi immune response.

Inventors: 
Ching, Wei-mei; Chen, Hua-wei
Patent Number: 
US7928194
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2007-07-27
Grant Date: 
2011-04-19
Grant time: 
1,362 days
Grant time percentile rank: 
25
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Recombinant antigens for the detection of coxiella burnetii

Patent image
NMRC

The invention relates to a method for the detection of prior exposure to Coxiella. burnetii infection by antibody-based assays using recombinant, immunodominant C. burnetii polypeptides. The invention also relates to the design of biotin or His-tagged C. burnetii proteins useful in the antibody-based assays as standardized antigen reagents.

Inventors: 
Ching, Wei-mei; Chao, Chien-chung; Li, Xuan; Chen, Hua-wei
Patent Number: 
US7824909
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2007-12-11
Grant Date: 
2010-11-02
Grant time: 
1,057 days
Grant time percentile rank: 
19
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Use of EEG to measure cerebral changes during computer-based motion sickness-inducing tasks

Patent image
NMRC

The invention relates to a method of determining early onset of motion sickness by brain imaging. The method discloses an objective means of determining the onset of motion sickness by evaluating a specific region of the brain. The method can also be utilized in evaluating the predisposition toward motion sickness in workers in occupations prone to motion sickness.

Inventors: 
Strychacz, Chris; Viirre, Erik
Patent Number: 
US7933645
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-03-30
Grant Date: 
2011-04-26
Grant time: 
1,853 days
Grant time percentile rank: 
34
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Fluorescence polarization instruments and methods for detection of exposure to biological materials by fluorescence polarization immunoassay of saliva, oral or bodily fluids

Patent image
NMRC

The inventive subject matter relates to a method for detecting the presence of a biological substance of interest in a test sample of saliva or oral fluid, comprising combining said test sample with a fluorescence-labeled ligand to said biological substance and detecting a change in the fluorescence polarization of said test sample produced by binding of said fluorescence-labeled ligand to said biological substance. In one aspect of the inventive subject matter, said method comprises additional steps for comparing the fluorescence polarization of said test sample with the fluorescence polarization of a control solution. Also provided is a miniaturized, portable apparatus for measuring the fluorescence polarization of a liquid sample.

Inventors: 
Cullum, Malford E.; Simonson, Lloyd G.; Schade, Sylvia Z.; Lininger, Linda A.; Mcarthur, Alan L.
Patent Number: 
US8114582
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2008-06-27
Grant Date: 
2012-02-14
Grant time: 
1,327 days
Grant time percentile rank: 
24
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Fluorescence polarization instruments and methods for detection of exposure to biological materials by fluorescence polarization immunoassay of saliva, oral or bodily fluids

Patent image
NMRC

The inventive subject matter relates to a method for detecting the presence of a biological substance of interest in a test sample of saliva or oral fluid, comprising combining said test sample with a fluorescence-labeled ligand to said biological substance and detecting a change in the fluorescence polarization of said test sample produced by binding of said fluorescence-labeled ligand to said biological substance. In one aspect of the inventive subject matter, said method comprises additional steps for comparing the fluorescence polarization of said test sample with the fluorescence polarization of a control solution. Also provided is a miniaturized, portable apparatus for measuring the fluorescence polarization of a liquid sample.

Inventors: 
Cullum, Malford E.; Simonson, Lloyd G.; Schade, Sylvia Z.; Lininger, Linda A.; Mcarthur, Alan L.
Patent Number: 
US7408640
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2003-11-05
Grant Date: 
2008-08-05
Grant time: 
1,735 days
Grant time percentile rank: 
31
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Methods for vaccinating against malaria

Patent image
NMRC

The invention pertains to methods for protecting against malaria infection by vaccination. The method of the invention involves priming an anti-malaria immune response with a DNA-based vaccine and boosting that response with a protein-based a vaccine. The method of the invention also relates to broadening the resulting immune response by boosting with a protein-based vaccine.

Inventors: 
Hoffman, Stephen L.; Wang, Ruobing; Epstein, Judith E.; Cohen, Joseph D.
Patent Number: 
US8232255
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2003-10-22
Grant Date: 
2012-07-31
Grant time: 
3,205 days
Grant time percentile rank: 
58
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Immunogenic capsule composition for use as a vaccine component against <i>Campylobacter jejuni </i>

Patent image
NMRC

An immunogenic composition, and method of using the composition, composed of a capsule polysaccharide polymer from one or more strains Campylobacter jejuni. The composition is either used alone or is conjugated to a carrier molecule, such as CRM197. An aspect of the invention is that the immunogenic composition induces an immune response without the induction of Gulliam Barre Syndrome.

Inventors: 
Guerry, Patricia; Baqar, Shahida; Monteiro, Mario Artur
Patent Number: 
US9084809
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-09-20
Grant Date: 
2015-07-21
Grant time: 
3,226 days
Grant time percentile rank: 
59
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Induction of an immune response against dengue virus using the prime-boost approach

Patent image
NMRC

The invention relates to methods for the induction of an immune response to dengue virus. The method of inducing an immune response against dengue virus comprises administration of a non-replicating immunogen followed by a boost with a tetravalent live attenuated viral vaccine. Another aspect of the inventive subject matter is a method of inducing an immune response against dengue virus using a heterologous prime-boost regimen with the priming immunogen comprising a DNA expression system, an adenovirus expression vector or a Venezuelan equine encephalitis virus replicon system and the boosting immunogen comprising the same without the DNA expression system. Each expression system contains DNA sequences encoding dengue viral proteins.

Inventors: 
Simmons, Monika; Porter, Kevin R.
Patent Number: 
US8241638
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2007-11-02
Grant Date: 
2012-08-14
Grant time: 
1,747 days
Grant time percentile rank: 
32
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Induction of an immune response against dengue virus using the prime-boost approach

Patent image
NMRC

The invention relates to methods for the induction of an immune response to dengue virus. The method of inducing an immune response against dengue virus comprises administration of a non-replicating immunogen followed by a boost with a tetravalent live attenuated viral vaccine. Another aspect of the inventive subject matter is a method of inducing an immune response against dengue virus using a heterologous prime-boost regimen with the priming immunogen comprising a DNA expression system, an adenovirus expression vector or a Venezuelan equine encephalitis virus replicon system and the boosting immunogen comprising the same without the DNA expression system. Each expression system contains DNA sequences encoding dengue viral proteins.

Inventors: 
Simmons, Monika; Porter, Kevin R.; Sun, Wellington
Patent Number: 
US8440202
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-10-26
Grant Date: 
2013-05-14
Grant time: 
566 days
Grant time percentile rank: 
10
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

<i>Orientia tsutsugamushi </i>truncated recombinant outer membrane protein (R47) and (R56) vaccines diagnostics and therapeutics for scrub typhus

Patent image
NMRC

A scrub typhus diagnostic method and vaccine using a composition comprising truncated r47 protein and truncated r56 protein is disclosed. Vaccines composed of r56 protein variants are also disclosed. Methods of reducing HIV viral loads using r47 and r56 proteins and antibodies raised against r47 and r56 are also disclosed.

Inventors: 
Ching, Wei Mei; Ge, Hong; Chao, Chien-chung
Patent Number: 
US7820395
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2007-10-23
Grant Date: 
2010-10-26
Grant time: 
1,099 days
Grant time percentile rank: 
20
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY; JACKSON H M FOUND MILITARY MED

Method and apparatus for removing particulate metals from dental waste water

Patent image
NMRC

An inline filter assembly to be used in conjunction with surgical or other procedures, near the patient or chairside in dental operations, that is capable of removing, by filtration, particulate matter from waste-water. The filter assembly is configured to permit easy and rapid changing of filters. The filter assembly also contains a series of stopcocks to permit easy and quick changing of filters while maintaining suction to the patient.

Inventors: 
Stone, Mark E.; Gullett, Jeffrey M.; Kuehne, John C.
Patent Number: 
US7182599
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2005-06-15
Grant Date: 
2007-02-27
Grant time: 
622 days
Grant time percentile rank: 
11
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Noise rejecting electronic stethoscope

Patent image
NMRC

An acoustic-electronic stethoscope that filters aberrant environmental background noise. The chest piece employs acoustic vents to inhibit resonant amplification of noise and contains a diaphragm design that focuses vibrational energy to a raised ring, which transfers and further focuses the energy to a piezoelectric polymer sensor with dual elements. The ensuing electrical signal is then preamplified with the low frequency sound, comprising predominantly background noise, filtered out. The stethoscope contains a binaural head set and output jack for down loading of data. Furthermore, areas normally subject to exposure and damage to water, such as the chest piece and headset, are water-tight.

Inventors: 
Kassal, James J.; Russotti, Joseph S.
Patent Number: 
US7991165
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-10-04
Grant Date: 
2011-08-02
Grant time: 
1,763 days
Grant time percentile rank: 
32
Claim count percentile rank: 
7
Citations percentile rank: 
1
'Cited by' percentile rank: 
2
Assignee: 
US NAVY

Antimicrobial electrostatic implantable medical device

Patent image
NMRC

A device and method for providing antimicrobial activity around a surgical implant. Antimicrobial activity is provided by the inclusion of a highly conductive material to a surgical implant and providing a low electrical charge to the implant. Electrical charge is provided by a static generator or battery attached to the implant or attached via electrical leads.

Inventors: 
Fleischmann, David
Patent Number: 
US8932294
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2012-08-29
Grant Date: 
2015-01-13
Grant time: 
867 days
Grant time percentile rank: 
15
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Adjustable head positioning device for use with cone beam CT scanner

Patent image
NMRC

A heading positioning apparatus and the method of use for cone-beam computed tomography (CBCT), and single photon emission computed tomography (SPECT).

Inventors: 
Grant, Gerald T.; Kondor, Shayne A.
Patent Number: 
US9456792
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2014-06-12
Grant Date: 
2016-10-04
Grant time: 
845 days
Grant time percentile rank: 
15
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Cloning and expression of the full length 110 kDa antigen of <i>Orientia tsutsugamushi </i>to be used as a vaccine component against scrub typhus

Patent image
NMRC

The inventive subject matter relates to a recombinant 110 kDa protein from O. tsutsugamuchi, Karp, Kato and Gilliam strains and for a DNA expression system containing DNA encoding the 110 kDa protein of O. tsutsugamuchi. The invention also relates to the use of these recombinant contructs in a formulation for the induction of a protective immune response against O. tsutsugamuchi invection using. The inventive subject matter also relates to a recombinant 110 kDa O. tsutsugamuchi protein or 110 kDa fragments for the production of antigen for use in immunodiagnosistic asssays for scrub typhus.

Inventors: 
Ching, Wei-mei; Chao, Chien-chung
Patent Number: 
US7371821
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2005-04-19
Grant Date: 
2008-05-13
Grant time: 
1,120 days
Grant time percentile rank: 
20
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Truncated recombinant major outer membrane protein antigen (R56) of orientia tsutsugamushi strains karp, kato and gilliam and its use in antibody based detection assays and vaccines

Patent image
NMRC

A recombinant, refolded non-fusion polypeptide expressed from a truncated r56 gene of the causative agent of scrub typhus, Orientia tsutsugamushi for the Karp, Kato and Gilliam strains has been produced. The invention is useful for detecting prior exposure to scrub typhus, screening for and/or identification of at least one infectious strain-similarity (i.e. a Karp-like, Kato-like or Gilliam-like strain) based on its strength of reaction toward a truncated protein and as a component in vaccine formulation sand production of immune globulins for passive prophylaxis and immunity in subjects.

Inventors: 
Ching, Wei-mei; Kelly, Daryl J.; Dasch, Gregory A.
Patent Number: 
US7846675
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2007-12-27
Grant Date: 
2010-12-07
Grant time: 
1,076 days
Grant time percentile rank: 
19
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Adhesin as immunogen against enterotoxigenic <i>Escherichia coli</i>

Patent image
NMRC

The inventive subject matter relates to the methods for the induction of immunity and prevention of diarrhea resulting from Escherichia coli. The inventive subject matter also relates to the use Escherichia coli adhesins as immunogens and to the construction of conformationally stability and protease resistant Escherichia coli adhesin constructs useful for inducing immunity to Escherichia coli pathogenic bacteria. The methods provide for the induction of B-cell mediated immunity and for the induction of antibody capable of inhibiting the adherence and colonization of Escherichia coli including enterotoxigenic Escherichia coli, to human cells.

Inventors: 
Savarino, Stephen J.
Patent Number: 
US9079945
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-01-10
Grant Date: 
2015-07-14
Grant time: 
3,472 days
Grant time percentile rank: 
63
Claim count percentile rank: 
2
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Recombinant antigens for diagnosis and prevention of spotted fever rickettsiae

Patent image
NMRC

The invention relates to the construction of recombinant, immunodominant polypeptides against spotted fever group Rickettsia. The invention also relates to a method for the use of the recombinant proteins, either singly or in combination, in detection and diagnostic assays of spotted fever. The proteins can also be used to induce immune response against spotted fever group Rickettsia.

Inventors: 
Ching, Wei-mei
Patent Number: 
US8623383
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2009-06-08
Grant Date: 
2014-01-07
Grant time: 
1,674 days
Grant time percentile rank: 
30
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Adenoviral vector-based malaria vaccines

Patent image
NMRC

The invention provides adenoviral vectors comprising an adenoviral genome comprising heterologous antigen-encoding nucleic acid sequences, such as Plasmodium nucleic acid sequences, operably linked to promoters. The invention further provides a method of inducing an immune response against malaria in a mammal comprising administering the adenoviral vectors to the mammal.

Inventors: 
Bruder, Joseph T.; Kovesdi, Imre; King, Richter C.; Mcvey, Duncan L.; Ettyreddy, Damodar R.; Doolan, Denise Louise; Carucci, Daniel John
Patent Number: 
US8765146
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2006-08-31
Grant Date: 
2014-07-01
Grant time: 
2,861 days
Grant time percentile rank: 
52
Claim count percentile rank: 
3
Citations percentile rank: 
5
'Cited by' percentile rank: 
1
Assignee: 
JACKSON H M FOUND MILITARY MED

Recombinant polypeptide construct comprising multiple enterotoxigenic <i>Escherichia coli </i>fimbrial subunits

Patent image
NMRC

The inventive subject matter relates to a recombinant polypeptide construct comprising enterotoxigenic Escherichia coli fimbrial subunits. The recombinant polypeptide constructs comprise multiple subunits to the same or different ETEC fimbrial types. The constructs are useful for inclusion in immunogenic formulations for the inductin of immunity against entertoxigenic Escherichia coli. The inventive subject matter also relates to the use of the recombinant polypeptide constructs in induce anti-enterotoxigenic Escherichia coli.

Inventors: 
Savarino, Stephen
Patent Number: 
US9328150
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2013-10-08
Grant Date: 
2016-05-03
Grant time: 
938 days
Grant time percentile rank: 
17
Claim count percentile rank: 
6
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Secreted <i>Campylobacter </i>flaggella coregulated proteins as immunogens

Patent image
NMRC

The invention relates to an immunogenic composition composed of secreted polypeptides derived from Campylobacter jejuni non-flagellar proteins that are coordinately expressed with the flagellar regulon. The invention also relates to a method of inducing an immune response to the non-flagellar protein polypeptides.

Inventors: 
Guerry-kopecko, Patricia; Baqar, Shahida
Patent Number: 
US8637041
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2012-06-19
Grant Date: 
2014-01-28
Grant time: 
588 days
Grant time percentile rank: 
10
Claim count percentile rank: 
5
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Recombinant antigens for diagnosis and prevention of murine typhus

Patent image
NMRC

The invention relates to the construction of recombinant, immunodominant Rickettsia typhi proteins. The invention also relates to a method for the use of the recombinant proteins, either singly or in combination, in detection and diagnostic assays. The proteins can also be used in anti-Rickettsia typhi immunogenic formulations.

Inventors: 
Ching, Wei-mei
Patent Number: 
US7544778
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2007-04-18
Grant Date: 
2009-06-09
Grant time: 
783 days
Grant time percentile rank: 
14
Claim count percentile rank: 
1
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Methods for downregulating CCR5 in T cells with anti-CD3 antibodies and anti-CD28 antibodies

Patent image
NMRC

Methods for modulating HIV-1 fusion cofactor expression by manipulating an accessory molecule on the surface of T cells, such as CD28, are described. The invention encompasses methods for modulating HIV-1 fusion cofactor expression by stimulating or inhibiting one or more intracellular signals which result from ligation of a surface receptor on a T cell which binds a costimulatory molecule. In one embodiment, expression of an HIV-1 fusion cofactor, such as CCR5, is downregulated by stimulating a CD28-associated signal in the T cell.

Inventors: 
June, Carl H.; Carroll, Richard G.; Riley, James L.; St. Louis, Daniel C.; Levine, Bruce L.
Patent Number: 
US7927595
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
1998-02-20
Grant Date: 
2011-04-19
Grant time: 
4,806 days
Grant time percentile rank: 
83
Claim count percentile rank: 
3
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US ARMY

Secreted <i>campylobacter </i>flagella coregulated proteins as immunogens

Patent image
NMRC

The invention relates to an immunogenic composition composed of secreted polypeptides derived from Campylobacter jejuni non-flagellar proteins that are coordinately expressed with the flagellar regulon. The invention also relates to a method of inducing an immune response to the non-flagellar protein polypeptides.

Inventors: 
Guerry-kopecko, Patricia; Baqar, Shahida
Patent Number: 
US8221764
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2007-05-08
Grant Date: 
2012-07-17
Grant time: 
1,897 days
Grant time percentile rank: 
34
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Multiplex amplification reaction method for determination of <i>Campylobacter jejuni </i>Penner/capsule type

Patent image
NMRC

The inventive method and associated reagents relate to a molecular approach to determining Campylobacter jejuni capsule/Penner types. The invention also relates to a method of identifying Campylobacter jejuni types using the inventive primers in a multiplex PCR assay.

Inventors: 
Poly, Frederic; Guerry, Patricia; Mason, Carl; Serichantalergs, Oralak
Patent Number: 
US8530166
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2011-02-22
Grant Date: 
2013-09-10
Grant time: 
931 days
Grant time percentile rank: 
17
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
JACKSON H M FOUND MILITARY MED

Psoralen-inactivated viral vaccine and method of preparation

Patent image
NMRC

A method to prepare inactivate viral vaccine by exposing the virus to a predetermined concentration of an inactivating psoralen, and a preselected intensity of ultraviolet radiation for a time period sufficiently long to render the virus non-infectious but less than that which would result in degradation of its antigenic characteristics.

Inventors: 
Kochel, Tadeusz J.; Maves, Ryan C.; Porter, Kevin
Patent Number: 
US9005633
Technical domain: 
Biotechnology and Healthcare
FIle Date: 
2010-07-17
Grant Date: 
2015-04-14
Grant time: 
1,732 days
Grant time percentile rank: 
31
Claim count percentile rank: 
4
Citations percentile rank: 
1
'Cited by' percentile rank: 
1
Assignee: 
US NAVY

Multiplex amplification reaction method for determination of Campylobacter jejuni Penner/capsule type

Patent image